PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10235_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 696aa    MW: 76068.9 Da    PI: 7.4962
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10235_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox14.65.8e-054054501954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHH........HHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVk........vWFqNrRak 54 
                  Fe   ++yp+ +++  LAk++gLt +qV+        +WF N R +
  RrC10235_p1 405 FEHflHPYPKDSDKHMLAKQTGLTRSQVRtlqtilvsNWFINARVR 450
                  554458***************9999997522222222799999987 PP

2BELL96.13.1e-312803351772
         BELL  17 eeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  ++V++rY+qy++q+q+vissFe++ag+gsak+YtslAlk+iSr+FrcLk+aia+qi
  RrC10235_p1 280 KKVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQI 335
                  68*****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.9E-65165333IPR006563POX domain
PfamPF075268.2E-44171332IPR006563POX domain
PROSITE profilePS500719.572383454IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-26385467IPR009057Homeodomain-like
CDDcd000863.99E-10386455No hitNo description
SMARTSM003892.2E-4386458IPR001356Homeobox domain
SuperFamilySSF466894.06E-13387461IPR009057Homeodomain-like
PfamPF059205.4E-16403450IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009610Biological Processresponse to symbiotic fungus
GO:0009737Biological Processresponse to abscisic acid
GO:0010197Biological Processpolar nucleus fusion
GO:0010201Biological Processresponse to continuous far red light stimulus by the high-irradiance response system
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 696 aa     Download sequence    Send to blast
MATYFHGNPP EISAGSNGGL QTLILMNPTT YVPYTQQDDH SNNSNNNTTN NSFVFLDSHA  60
PPQNVSEQFV GIPLSGHEAA SITAAGNISV LQGYPPRVQY SLYNSHQVDP THHQAACETP  120
RAQRGLSLTL SSQQQQQQRQ TLHHVGFGSG EDIRVGSGST ASGVTNGIAN LVSSKYLKAA  180
QELLDEVVKA DSNDINTKSQ LFSSKKGTSV TDTKAVGKSS AGAGEGSGDG GEASGKRSVE  240
LGTAERQEIQ MKKAKLSSML HEVTTTLHIT SFDVIAWEMK KVEQRYRQYH QQMQMVISSF  300
EQAAGIGSAK SYTSLALKTI SRQFRCLKEA IAGQIKVANK SLGEEDSVSG VGRFEGSRLK  360
FVDHHLRQQR ALQQLGMIQH PSNNAWRPQR GLPERAVSVL RAWLFEHFLH PYPKDSDKHM  420
LAKQTGLTRS QVRTLQTILV SNWFINARVR LWKPMVEEMY AEEMKEQGKN MGSMEKTQNL  480
DENIEDSASK SISNQEKMIS MGGGGGADNY HLNPSHNGDL EGVTGMQGSP KRLRTSDETM  540
MQPINEGFSS NEKITMKILE ERQGIRSDGG YPFMGSFGQY QMDEMSRFNV AVSDQELLAQ  600
RFSGNNNGVS LTLGLPHCDS LSSTHHQGFM QTHHGIQIGR SVKIGETEEY GNSVINGGSG  660
TAATAHASAA AAAAYNGINI QNQKRYVAQL LPDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-14392458563Homeobox protein Meis2
3k2a_B5e-14392458563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013683591.10.0BEL1-like homeodomain protein 1
RefseqXP_022554766.10.0BEL1-like homeodomain protein 1
SwissprotQ9SJ560.0BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLA0A0D3B5560.0A0A0D3B556_BRAOL; Uncharacterized protein
STRINGBo3g029830.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.30.0BEL1-like homeodomain 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]