PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10173_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LBD
Protein Properties Length: 192aa    MW: 21410.3 Da    PI: 6.4928
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10173_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.74.7e-4491081100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da++slv+eA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  RrC10173_p1   9 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVHQRADAVNSLVFEANARVRDPVYGCVGAISYLQNQVSQLQMQLAVAQ 106
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  RrC10173_p1 107 AE 108
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8048109IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-439106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGGPGSSSPC ASCKLLRRRC AKDCIFAPYF PPDDPHKFAI VHKVFGASNV SKMLQELPVH  60
QRADAVNSLV FEANARVRDP VYGCVGAISY LQNQVSQLQM QLAVAQAEIL CIQMQHEQPL  120
QSHHQVLELD QDEKALLLNN NNINNCNNDN NNLGYAMSSG QFNSNFASPS SIMQMQMQMQ  180
MQDPLKQESL WT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-5041106112LOB family transfactor Ramosa2.1
5ly0_B2e-5041106112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1643060.0AB164306.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like gene 5 protein, partial cds.
GenBankAB4738380.0AB473838.1 Arabidopsis thaliana ASL5 mRNA for ASYMMETRIC LEAVES2-like 5 protein, complete cds.
GenBankAY0869600.0AY086960.1 Arabidopsis thaliana clone 29970 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013635070.11e-140PREDICTED: LOB domain-containing protein 12
RefseqXP_013731173.11e-140LOB domain-containing protein 12
SwissprotQ8LBW31e-111LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0D3C3011e-139A0A0D3C301_BRAOL; Uncharacterized protein
TrEMBLA0A3P6CHN31e-139A0A3P6CHN3_BRAOL; Uncharacterized protein
STRINGBo4g170770.11e-140(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-105LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]