PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC10133_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LFY
Protein Properties Length: 114aa    MW: 12515.4 Da    PI: 7.5311
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC10133_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY137.71.4e-4211141116
      FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifr 98 
                  mdpe f++ lf+w+p  a++++p+ + + +++  +p++ +++a  ++l +l  lf  yGvr++t+akiaelGft+stLv+mkdeel+d+ +sls+ifr
  RrC10133_p1   1 MDPEGFTSGLFRWNPTRAIVQAPTPVPQPQQQ--SPATPQTVAFGMRLGGLVGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMKNSLSHIFR 96 
                  9*************877777777666555543..333457777888899************************************************* PP

      FLO_LFY  99 ldllvGeryGikaavrae 116
                  ++llvGeryGikaavrae
  RrC10133_p1  97 WELLVGERYGIKAAVRAE 114
                  *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.0E-441114IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAIV QAPTPVPQPQ QQSPATPQTV AFGMRLGGLV GLFGPYGVRF  60
YTAAKIAELG FTASTLVGMK DEELEDMKNS LSHIFRWELL VGERYGIKAA VRAE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ude_A2e-2046114876GINLFY PROTEIN
4ude_B2e-2046114876GINLFY PROTEIN
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls floral meristem identity. Is required very early in flower development and may act here as a transcription factor.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZ183621e-142Z18362.1 Brassica oleracea gene encoding BOFH.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013646985.12e-55putative transcription factor BOFH
SwissprotQ055363e-55BOFH_BRAOB; Putative transcription factor BOFH
TrEMBLA5YYH16e-55A5YYH1_ARATH; Leafy (Fragment)
TrEMBLQ3ZLS66e-55Q3ZLS6_SELAU; LEAFY protein (Fragment)
STRINGBra019619.1-P5e-54(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.14e-53floral meristem identity control protein LEAFY (LFY)