PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30226.m002015
Common NameLOC8289299, RCOM_1773230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HD-ZIP
Protein Properties Length: 378aa    MW: 41974.4 Da    PI: 7.0438
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30226.m002015genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.12.6e-17208262256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ +++keq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  30226.m002015 208 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLSLRPRQVEVWFQNRRARTK 262
                    788899***********************************************98 PP

2HD-ZIP_I/II127.94.2e-41208296190
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                    +kk+rlskeq+++LEesF+e+++L+p++K +la++L l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +
  30226.m002015 208 RKKLRLSKEQSAFLEESFKEHNTLNPKQKLALAKQLSLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-A 296
                    69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.5E-17191258IPR009057Homeodomain-like
SuperFamilySSF466895.56E-18197265IPR009057Homeodomain-like
PROSITE profilePS5007116.973204264IPR001356Homeobox domain
SMARTSM003893.9E-15206268IPR001356Homeobox domain
PfamPF000469.2E-15208262IPR001356Homeobox domain
CDDcd000862.65E-15208265No hitNo description
PROSITE patternPS000270239262IPR017970Homeobox, conserved site
PfamPF021832.6E-11264297IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.5E-24264307IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MELGLSLGDA SKPLGFIEKA RDVSSKRRLG FCMGLSIDPN PRNEQQDADH HHDEQEAEED  60
GDKGKHSSNN YSTDTAATTS TIKIKRAAPD HDLIDTDHQH HRRPSTDPPI IQLDLLPNTP  120
VVVPRHHHHA LLWPSSDNGS YDAKGLDVNR LPAVEEAEDG AALSSSTPNS AASSFQMDFC  180
IYGKGGNHHE GERASSRASD EDENGSARKK LRLSKEQSAF LEESFKEHNT LNPKQKLALA  240
KQLSLRPRQV EVWFQNRRAR TKLKQTEVDC EYLKRCCETL TEENRRLHKE LQELRALTSS  300
NPFYMQVPAT TLTMCPSCER VATTSTATAT TTTTTTTTKN NISTEPASSK GTGLSLSTKT  360
RLYPFVHTQT HSHQPTAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1256264RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30226.m002015
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1473521e-136EF147352.1 Populus trichocarpa clone WS0122_O02 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512174.10.0homeobox-leucine zipper protein HOX11
SwissprotA2YW038e-87HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
TrEMBLB9REK50.0B9REK5_RICCO; Homeobox protein, putative
STRINGXP_002512174.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-70homeobox from Arabidopsis thaliana