PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30190.m011066
Common NameRCOM_1681810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRF
Protein Properties Length: 233aa    MW: 25667.9 Da    PI: 9.3517
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30190.m011066genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC81.95.7e-26140184145
            WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                    d+epgrCrRtDGKkWRCs+++l+++k+CErH+hrgr+rsrk +e+
  30190.m011066 140 DPEPGRCRRTDGKKWRCSKEALPDQKYCERHMHRGRQRSRKLVEA 184
                    79***************************************9985 PP

2QLQ38.53.5e-1471105337
            QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                    FT  Qlq+L  Q l+yKy+ a+ PvP +L+++i+k
  30190.m011066  71 FTILQLQELQLQSLIYKYIEAGCPVPYNLVLPIWK 105
                    7888*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009510.001969105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.29970105IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.5E-1071104IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.77140184IPR014977WRC domain
PfamPF088796.1E-22141183IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MEAQSPPSKI ARLADSSTEK GNYLTMERHG SGSPPIGLGL ALGRSGSIDH HQHHRPIPAT  60
GYTKSSSSCG FTILQLQELQ LQSLIYKYIE AGCPVPYNLV LPIWKSVSSS LGNLNSTLYQ  120
LYPSFMGASQ LHLEYRNGMD PEPGRCRRTD GKKWRCSKEA LPDQKYCERH MHRGRQRSRK  180
LVEAASQTKT SDTATSTNLS ISLPASSATS NVNPFPMCGF YLNTDHPGAI QNN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509650.21e-175PREDICTED: growth-regulating factor 10
SwissprotQ6AWX77e-44GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLB9RBW61e-175B9RBW6_RICCO; Putative uncharacterized protein
STRINGPOPTR_0001s08310.14e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-32growth-regulating factor 2