PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30190.m010925
Common NameLOC8271446, RCOM_1677010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 386aa    MW: 44685.2 Da    PI: 8.7741
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30190.m010925genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF45.69e-151052244
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    ie +s r  t+ kR++ + KK +E S+LC++e+++iif+++ 
  30190.m010925 10 LIEKESTRMLTYQKRKKSLVKKVSEFSILCGVEACLIIFAPKH 52
                   5999***********************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.2E-15166IPR002100Transcription factor, MADS-box
PROSITE profilePS5006617.044153IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-17184IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-8323IPR002100Transcription factor, MADS-box
CDDcd002663.60E-20573No hitNo description
PfamPF003197.7E-161153IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MGHSRIKMEL IEKESTRMLT YQKRKKSLVK KVSEFSILCG VEACLIIFAP KHKDQPVKKL  60
DTVWPPNSDE AKSIINKYKK TDQARCYLVS HYFLDKKKKL DVEISKLQKQ VYEAIYPSWD  120
IHLDNFSEDR LRVLLTRLES KLQVADQKLN LFQDNQNNQM DMFVPRMIYN SHNMECYMTR  180
SDNLQVFPEL MRPLDVQFPI SFIRGQNPYS NFMASNKENV CSTSLQLLSD SHSTIAGRSL  240
ADMNNENNNS NSRNLQWQLF SPKSLDVQLP IDCQTKQSFQ GMPLNRNLME DVITKMSNNQ  300
NFSNQFGDRG ISNIPSLSGL SYVNPQFMMP ANFVQSNVDV SMPLQTMLPR PQPQVPLSSL  360
LDQAYPSEVD KFCYGIGFLK QEHNYK
Cis-element ? help Back to Top
SourceLink
PlantRegMap30190.m010925
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002509511.10.0agamous-like MADS-box protein AGL90
TrEMBLB9RBH70.0B9RBH7_RICCO; Uncharacterized protein
STRINGXP_002509511.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-27M-type_MADS family protein