PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m009082
Common NameLOC8264608, RCOM_1620060
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 512aa    MW: 56359 Da    PI: 7.5786
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m009082genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP136.39.2e-43172247277
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    Cqv gC++dls++k+yh+rhkvCevhsk+p+v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  30174.m009082 172 CQVYGCNKDLSSLKDYHKRHKVCEVHSKTPKVIVNGVEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 247
                    **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-34165233IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.975169246IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-40170250IPR004333Transcription factor, SBP-box
PfamPF031102.2E-32172245IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MDSWRFTTAE GKSLFFSDEI DVSTDSFGRS RKTLTGWDGE SVENMEFIDL GFSEMHKRQF  60
YGTSNTGFGI LGSSGEVNFD ASSNKIELSS PSCMIASNSS LESGSNHSNS VMEANSHDSS  120
SLIDLKLGRL GDGKDVDNSK FLKERSVVSS VTPTFQAKRA RTMNSRTQTP FCQVYGCNKD  180
LSSLKDYHKR HKVCEVHSKT PKVIVNGVEQ RFCQQCSRFH LLVEFDDGKR SCRKRLAGHN  240
ERRRKPQFGA LSGRPHKLLQ AYQGTKFLGT SLPKRASFLF PNMRPGGILY PEIYEQANCC  300
RPVKLEEKSC YGTNSQLLQK SFLHLHGNGI QNTSGISPPA SEDFTVFSAS SNIHELAGVS  360
HSSCALSLLS AESQDLSHSA GIIMARPLIS QVGRSHHILG FSDKSSLGSS EKYVGDIFQS  420
SGMSSLKTNH MGPLMGSCAG HATDGQIESD EYLQNQGPDF VSDKFCISAE NGTTVDLLQL  480
SSHLHRVEQQ RNSMQVKHEL EECSSFLATY GA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-291712451084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap30174.m009082
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512054.10.0squamosa promoter-binding-like protein 6 isoform X2
TrEMBLB9REB50.0B9REB5_RICCO; LIGULELESS1 protein, putative
STRINGXP_002512054.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.18e-60SBP family protein