PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30174.m008969
Common NameLOC8258519, RCOM_1613930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HD-ZIP
Protein Properties Length: 825aa    MW: 89458.4 Da    PI: 6.1829
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30174.m008969genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.6e-21123178156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  30174.m008969 123 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 178
                    688999***********************************************999 PP

2START204.83.4e-643325561206
                    HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEE CS
          START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetle 83 
                    ela++a++elvk+a+ ++p+W +s     e++n +e++++f++  +     +  ea+r+ g+v+ ++  lve+l+d++ +W e+++    + +t++
  30174.m008969 332 ELALAAMDELVKMAQTDDPLWIRSLeggrEMLNHEEYVRTFTPCIGmkpsgFVFEASREAGMVIINSLALVETLMDSN-RWAEMFPcviaRTSTTD 426
                    5899**************************************9998999999**************************.***************** PP

                    EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE- CS
          START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdl 172
                    vissg      g lqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  ++ +  + ++ +++lpSg+++++++ng+skvtwveh+++
  30174.m008969 427 VISSGmggtrnGSLQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRETSGGPAFANCRRLPSGCVVQDMPNGYSKVTWVEHAEY 522
                    ***********************************************************999********************************** PP

                    -SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 173 kgrlphwllrslvksglaegaktwvatlqrqcek 206
                    +++ +h+l+r+l++sg+ +ga++wvatlqrqce+
  30174.m008969 523 DESPIHQLYRPLISSGMGFGAQRWVATLQRQCEC 556
                    ********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-20106180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-22110180IPR009057Homeodomain-like
PROSITE profilePS5007117.216120180IPR001356Homeobox domain
SMARTSM003899.9E-18121184IPR001356Homeobox domain
CDDcd000861.34E-18122180No hitNo description
PfamPF000461.4E-18123178IPR001356Homeobox domain
PROSITE patternPS000270155178IPR017970Homeobox, conserved site
PROSITE profilePS5084844.77323559IPR002913START domain
SuperFamilySSF559612.47E-33325556No hitNo description
CDDcd088752.36E-125327555No hitNo description
PfamPF018523.5E-56332556IPR002913START domain
SMARTSM002341.0E-48332556IPR002913START domain
SuperFamilySSF559611.51E-23585818No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 825 aa     Download sequence    Send to blast
MSFGGFLENG SPGGGGARIV ADIPFNNNSS SSSTNMPTGA IAQPRLLSPS FTKSMFNSPG  60
LSLALQQPNI DGQGDHVARM AENFETIGGR RSREEEHESR SGSDNMDGAS GDDQDAADNP  120
PRKKRYHRHT PQQIQELEAL FKECPHPDEK QRLELSKRLC LETRQVKFWF QNRRTQMKTQ  180
LERHENSLLR QENDKLRAEN MTIRDAMRNP ICSNCGGPAI IGDISLEEQH LRIENARLKD  240
ELDRVCALAG KFLGRPISSL ASSIGPPMPN SSLELGVGNN GFAGLSTVAT TLPLGPDFGG  300
GISTLNVVTQ TRPGNTGVTG LDRSLERSMF LELALAAMDE LVKMAQTDDP LWIRSLEGGR  360
EMLNHEEYVR TFTPCIGMKP SGFVFEASRE AGMVIINSLA LVETLMDSNR WAEMFPCVIA  420
RTSTTDVISS GMGGTRNGSL QLMHAELQVL SPLVPVREVN FLRFCKQHAE GVWAVVDVSI  480
DTIRETSGGP AFANCRRLPS GCVVQDMPNG YSKVTWVEHA EYDESPIHQL YRPLISSGMG  540
FGAQRWVATL QRQCECLAIL MSSTVPARDH TAAITASGRR SMLKLAQRMT DNFCAGVCAS  600
TVHKWNKLNA GNVDEDVRVM TRKSVDDPGE PPGIVLSAAT SVWLPVSPQR LFDFLRDERL  660
RSEWDILSNG GPMQEMAHIA KGQDHGNCVS LLRASAMNAN QSSMLILQET CIDAAGSLVV  720
YAPVDIPAMH VVMNGGDSAY VALLPSGFAI VPDGPGSRGS PTNQNGGGNN GGGPNRVSGS  780
LLTVAFQILV NSLPTAKLTV ESVETVNNLI SCTVQKIKAA LQCES
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap30174.m008969
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511801.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9RDL20.0B9RDL2_RICCO; Homeobox protein, putative
STRINGXP_002511801.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]