PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m014245
Common NameLOC8269959, RCOM_1602440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 1073aa    MW: 119320 Da    PI: 7.9937
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m014245genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.99.2e-41148225178
                    --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
            SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                    +Cqv++C++dls+ak+yhrrhkvCe hsk++++lv +++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  30170.m014245 148 MCQVDNCKEDLSNAKDYHRRHKVCELHSKSTQALVGKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 225
                    6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33143210IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.804146223IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-37147227IPR004333Transcription factor, SBP-box
PfamPF031101.5E-29149222IPR004333Transcription factor, SBP-box
CDDcd002046.05E-4839968No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1073 aa     Download sequence    Send to blast
MEEVGAQVAS PIFIHQALSS RFCDAASMAK KRDLSYQTSN FQHHRFPQNP RDNWNPKAWD  60
WDSVRFVAKP LDADTNVLQL GTASSDHQKK TNASVNHNLT LKNAPPAGDE DDGLRLNLAG  120
VFNAVEEPVS RPNKRVRSGS PGTATYPMCQ VDNCKEDLSN AKDYHRRHKV CELHSKSTQA  180
LVGKQMQRFC QQCSRFHPLS EFDEGKRSCR RRLAGHNRRR RKTQPEDVTS RLLLPGNRDT  240
ASSANLDIVN LLTALARTQG KHADKRINAS SMPDRDQLIQ ILSKINSLPL PMDLAAQLSN  300
IGSLNRKNPE QPSSEHQNRL LGTASSPSTM DLLAVLSATL AASAPDALAF LSQRSSQSSD  360
SEKSKLTCVD QDAGPNLQKR PIVDFPSMAL EKSSSCYQSP VEESDCQLQE SHPNLPLQLF  420
SSSPEESSPP KLASSRKYFS SDSSNPSEGR SPSSSPPVMQ KLFPLQSNAD TVKSEKVSIT  480
REVNANIEGS RSHGSILPLE LFRGSDGRAV QSSYQSFPYQ AGYTSSSGSD HSPSSQNSDA  540
QDRTGRIIFK LFDKDPSHFP GKLRTQIYNW LSNSPSEMES YIRPGCVVLS VYLSMSSAKW  600
ERLERNLLQQ VDSLVQDSYS DFWRTGRFLL HTGRQLASHK DGNIRLCKSW RTWSSPELIS  660
VSPVAVVGGQ ETSLLLRGRN LTNAGTKIHC TYMGGYTSME VMESTLPGAI YDEINMSGFK  720
VHGSPPSSLG RLFIEVENGF KGNSFPVIVA DATICKELRL LECEFDEISK DCDIISEEQA  780
QYLGRPKSRE EALHFLNELG WLFQRRRASS VYEIPDYSLG RFKFLLIFSV ERDYCALVKT  840
ILDMLVERNM GMSGLSKECL EMLSEIHLVN RAVKRQCRKM VDLLIHYYIN CSELSSKSYI  900
FPPSLAGPGG ITPLHLAACT SGSDDLVDAL TNDPQEIGLS CWNSLVDANH QSPYDYATMT  960
DNHSYNKLVA HKHADRRNGQ VSVRIGNEIV QSLSSRMISD VEQERRSCAR CATVAAKYNR  1020
RIMGSQGLLQ RPYIHSMLAI AAVCVCVCLF LRGAPDIGLV APFKWETLDY GTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-31139222184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap30170.m014245
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510746.10.0squamosa promoter-binding-like protein 14
RefseqXP_015575485.10.0squamosa promoter-binding-like protein 14
RefseqXP_015575492.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLB9R8V30.0B9R8V3_RICCO; Squamosa promoter-binding protein, putative
STRINGXP_002510746.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]