PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m013868
Common NameLOC8278862, RCOM_1590260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 422aa    MW: 46116.5 Da    PI: 10.344
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m013868genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.68.4e-16345397557
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                    +r+rr++kNRe+A rsR+RK+a++ eLe +v++L++eN++L+k+  e+ ++ +
  30170.m013868 345 RRQRRMIKNRESAARSRARKQAYTMELEAEVAKLKEENQELRKKQAEIMEMQK 397
                    79*****************************************9999998865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-14341406IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.473343394IPR004827Basic-leucine zipper domain
CDDcd147071.01E-26345399No hitNo description
PfamPF001701.3E-13345397IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-14345394No hitNo description
SuperFamilySSF579597.5E-11345394No hitNo description
PROSITE patternPS000360348363IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0010255Biological Processglucose mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGTNLNFKNF NTNDPSSDGS GNRPPVNLPL TRQTSIYSLT FDEFQSSMGG IGKDFGSMNM  60
DELLKNIWTA EETHNMVASC SGTQGQEGLQ RQGSLTLPRT LSQKTVDEVW KDISKEYGNG  120
NANGGVVTNL PQRQQTLGEM TLEEFLVRAG VVREDAQLAA KVNTNGGFFG DFSRSGNNAS  180
LGIGFQQNRV LGLNINNGNN NNSNTNQISL QSSNLPLNVN GVRSNQANIQ QQQQQQRQQQ  240
QQQIFPKQPN LGYVTQVPLQ NSPGIRGGIM GIGDQGINGG LMQGGGMGMI GLGGVATGSP  300
ANQLSSDGIT KSNGDTSSVS PVPYVFNGGL RGRRAGGAVE KVVERRQRRM IKNRESAARS  360
RARKQAYTME LEAEVAKLKE ENQELRKKQA EIMEMQKNQV MEMMNQQQGK RRCLRRTQTG  420
PW
Functional Description ? help Back to Top
Source Description
UniProtInvolved in ABA and stress responses and acts as a positive component of glucose signal transduction. Functions as transcriptional activator in the ABA-inducible expression of rd29B. Binds specifically to the ABA-responsive element (ABRE) of the rd29B gene promoter. {ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00186DAPTransfer from AT1G45249Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap30170.m013868
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt, abscisic acid (ABA), cold and glucose. {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:11005831, ECO:0000269|PubMed:15361142, ECO:0000269|PubMed:16284313, ECO:0000269|PubMed:16463099}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510209.10.0bZIP transcription factor TRAB1
RefseqXP_015575003.10.0bZIP transcription factor TRAB1
SwissprotQ9M7Q41e-137AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLB9R7B60.0B9R7B6_RICCO; DNA binding protein, putative
STRINGXP_002510209.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G45249.11e-105abscisic acid responsive elements-binding factor 2
Publications ? help Back to Top
  1. Gao S, et al.
    ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
    Mol Plant, 2016. 9(9): p. 1272-1285
    [PMID:27373216]
  2. Seok HY, et al.
    Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response.
    Planta, 2017. 245(2): p. 329-341
    [PMID:27770200]