PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m013776
Common NameRCOM_1588490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MIKC_MADS
Protein Properties Length: 230aa    MW: 26224.9 Da    PI: 7.4547
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m013776genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.22.2e-28958150
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                   krien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g+l  +s
  30170.m013776  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRLSLFS 58
                   79*******************************************98776 PP

2K-box21.11.3e-08100162972
          K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnel 72 
                     ++ + e+lqqe+++ k+++e++++++R l G+  +  +l e +  eq Le++lk++  +K+ +
  30170.m013776 100 IADGQLEELQQEITRFKSQVEEMEKQLRILEGNLSHITTLCEAEYQEQILEEALKRVQVRKQ-V 162
                    778899**************************86666667777788************9995.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.2E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.857161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-29278IPR002100Transcription factor, MADS-box
CDDcd002651.24E-37275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-26323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-261055IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0032440Molecular Function2-alkenal reductase [NAD(P)] activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MGRVKLQIKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRLSLFSGI  60
KSIEEILMRY VNLPEHERGR ALGKLKAEGD QSHRATSPPI ADGQLEELQQ EITRFKSQVE  120
EMEKQLRILE GNLSHITTLC EAEYQEQILE EALKRVQVRK QVLEDNCNNT SGRPPAANSQ  180
CDEAHIPIKN AYVNGFDTES PNNVLDWIRQ RDPQVEILNF LGSNGLLRLR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-19181180MEF2 CHIMERA
6byy_B4e-19181180MEF2 CHIMERA
6byy_C4e-19181180MEF2 CHIMERA
6byy_D4e-19181180MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL30 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30170.m013776
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1429131e-81GU142913.1 Hevea brasiliensis MADS-box transcription factor 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572503.11e-165agamous-like MADS-box protein AGL104 isoform X1
SwissprotQ1PFC23e-48AGL66_ARATH; Agamous-like MADS-box protein AGL66
TrEMBLB9R7401e-169B9R740_RICCO; Mads box protein, putative
STRINGXP_002510133.11e-169(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136651922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.11e-50AGAMOUS-like 66
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]