PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m013705
Common NameLOC8275772, RCOM_1595650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 163aa    MW: 18649.8 Da    PI: 6.6327
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m013705genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.52.4e-123087562
                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62
                   ++ +r+ +NRe+ArrsR RK++ ++ L   v +L + N++    ++  +++  ++++e
  30170.m013705 30 RKRKRMLSNRESARRSRMRKQQHLDDLMSQVSQLRKDNSQILTSINITTQHFLNVEAE 87
                   67899**********************************9998888777776666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-112075No hitNo description
SMARTSM003386.1E-192690IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.5652891IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.2E-123082No hitNo description
PfamPF001702.0E-93075IPR004827Basic-leucine zipper domain
CDDcd147022.26E-193181No hitNo description
PROSITE patternPS0003603348IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MASSSGNSSG SSQLQNSGSE EDMQVLMDQR KRKRMLSNRE SARRSRMRKQ QHLDDLMSQV  60
SQLRKDNSQI LTSINITTQH FLNVEAENSI LRAQMMELSQ RLDSLNEILN YINTTTSNGI  120
YEIDHPHHHH QDATAVAADS FMNPLNLIYL NQPIMASPDL FQY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14249RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30170.m013705
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510435.11e-116bZIP transcription factor 11
SwissprotC0Z2L52e-49BZP44_ARATH; bZIP transcription factor 44
TrEMBLB9R7Z21e-115B9R7Z2_RICCO; Ocs element-binding factor, putative
STRINGXP_002510435.11e-116(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61334147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.15e-47basic leucine-zipper 44
Publications ? help Back to Top
  1. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  2. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]