PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30170.m013648
Common NameLOC8265230, RCOM_1585300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HD-ZIP
Protein Properties Length: 274aa    MW: 30107.7 Da    PI: 8.013
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30170.m013648genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.62.4e-19126180256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tk+q  +Le+ F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  30170.m013648 126 RKKLRLTKQQSAILEDNFKEHSTLNPKQKQALAEQLNLRPRQVEVWFQNRRARTK 180
                    78889************************************************98 PP

2HD-ZIP_I/II122.61.9e-39126214190
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                    +kk+rl+k+q+++LE++F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eL+ +
  30170.m013648 126 RKKLRLTKQQSAILEDNFKEHSTLNPKQKQALAEQLNLRPRQVEVWFQNRRARTKLKQTEVDCEVLKKCCETLTEENNRLQKELQELK-S 214
                    69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-18120183IPR009057Homeodomain-like
PROSITE profilePS5007117.281122182IPR001356Homeobox domain
SMARTSM003895.4E-16124186IPR001356Homeobox domain
CDDcd000862.00E-15125183No hitNo description
Gene3DG3DSA:1.10.10.604.7E-18126180IPR009057Homeodomain-like
PfamPF000469.0E-17126180IPR001356Homeobox domain
PROSITE patternPS000270157180IPR017970Homeobox, conserved site
SMARTSM003407.8E-20182226IPR003106Leucine zipper, homeobox-associated
PfamPF021834.6E-10182215IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MGFGISDHGT CNTGLGLGLI CHEKEENSSQ HQSDRHRQGK KKKLSLKYDH MFPSLTLGLP  60
QEAYASVNKV EPDLQPQASS PSAVSSFSNS SVKKERDSGG GGGGEEVDGE RVSSRVSDED  120
EEGSPRKKLR LTKQQSAILE DNFKEHSTLN PKQKQALAEQ LNLRPRQVEV WFQNRRARTK  180
LKQTEVDCEV LKKCCETLTE ENNRLQKELQ ELKSLKLQAA PFYMQLPAAT LTMCPSCERI  240
GGGGDGSSST STITVGVGSK PHFYSPFTHP SAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174182RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30170.m013648
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510028.10.0homeobox-leucine zipper protein HAT22
SwissprotP466042e-86HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLB9R6T50.0B9R6T5_RICCO; Homeobox protein, putative
STRINGXP_002510028.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.15e-68HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]