PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30156.m001718
Common NameLOC8277733, RCOM_1547780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GeBP
Protein Properties Length: 383aa    MW: 42740.1 Da    PI: 4.7283
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30156.m001718genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573118.63.3e-37151243398
         DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                    +qrlwse+Deiv+L Gl ++k+++g++p++++ afye++kks++++vs++ql++KirrLKkK+ +++k+   g++p+f+k+hd+k+f+lskk+Wg+
  30156.m001718 151 VQRLWSEDDEIVVLNGLSQYKSEKGADPYSEMGAFYEYIKKSLHVDVSRNQLIDKIRRLKKKYGNNMKR---GQDPVFTKSHDEKSFQLSKKLWGK 243
                    79*******************************************************************...**********************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045048.9E-33152242IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MAPRRLSENP PPAASDEEEE EESDSESDEG NTEQNGAVDK HDDENDNGNP DDDEEEEEEE  60
EDKESPVSKK SVVPATPQKS DSATESDDSE STQPSPSLSA FTIKLYNRSP KPNKTASSKR  120
PAESDSMGPT NKKKKPTAGV GEDEVVKRGA VQRLWSEDDE IVVLNGLSQY KSEKGADPYS  180
EMGAFYEYIK KSLHVDVSRN QLIDKIRRLK KKYGNNMKRG QDPVFTKSHD EKSFQLSKKL  240
WGKNDQNVNN DNDDNIAGGG VTLGLLANQL SSKKPIRAPN VEEKDQIKSK EKIETKSAVV  300
KGEGVWEKYP SLSEALESEE GLSDGVKVSL RKHLGMIEKG KLKELDDKWK KLRQAELELF  360
VQRMELVHDQ VQLALHSIKS SDI
Cis-element ? help Back to Top
SourceLink
PlantRegMap30156.m001718
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515707.10.0STOREKEEPER protein
TrEMBLB9RPN80.0B9RPN8_RICCO; Transcription regulator, putative
STRINGXP_002515707.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-30DNA-binding storekeeper protein-related transcriptional regulator