PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30147.m014288
Common NameLOC8258278, RCOM_1496700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HD-ZIP
Protein Properties Length: 799aa    MW: 88096.9 Da    PI: 6.252
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30147.m014288genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.8e-20101156156
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    ++k +++t+ q++eLe +F+++++p++++r eL+++lgL+ +q+k+WFqNrR+++k
  30147.m014288 101 KKKYHRHTPLQIQELEVCFKECPHPDEKQRLELSRRLGLESKQIKFWFQNRRTQMK 156
                    79999************************************************999 PP

2START189.91.3e-593065292206
                    HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEE CS
          START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlev 84 
                    la +a++elvk a+ + p+W ks     + +n++e++++f++  +     +  ea r++g+v+ +   lve+l+d++ +W e ++    +a+t++v
  30147.m014288 306 LAVAAMDELVKIAQIDNPLWIKSLdggkDTLNYEEYMRTFSPCIGmkpnsFIPEATRDTGIVIINILALVEILMDVN-RWLEAFPsliaRASTIDV 400
                    6789*************************************999899999999************************.****************** PP

                    ECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE-- CS
          START  85 issg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlk 173
                    issg      galq+m+ae+q+ splvp R + f+R+++q+++g+wv+vdvS+d + + ++ ++++ +++lpSg+++++++ng skvtwveh +++
  30147.m014288 401 ISSGmagtknGALQVMNAEFQVVSPLVPvRQVRFLRFCKQHSEGVWVVVDVSIDANLESSNAHPFAACRRLPSGCILQEMPNGCSKVTWVEHSEYD 496
                    ***********************************************************99*********************************** PP

                    SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
          START 174 grlphwllrslvksglaegaktwvatlqrqcek 206
                    ++ +h+l+rs+++sg  +ga++wvatlqr+ce+
  30147.m014288 497 ESAVHQLYRSILSSGKGFGAQRWVATLQRYCEC 529
                    *******************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.0E-2186152IPR009057Homeodomain-like
SuperFamilySSF466895.01E-2087158IPR009057Homeodomain-like
PROSITE profilePS5007117.13598158IPR001356Homeobox domain
SMARTSM003891.9E-17100162IPR001356Homeobox domain
PfamPF000465.6E-18101156IPR001356Homeobox domain
CDDcd000863.08E-18101158No hitNo description
PROSITE patternPS000270133156IPR017970Homeobox, conserved site
SuperFamilySSF559611.32E-32296529No hitNo description
PROSITE profilePS5084840.138296532IPR002913START domain
CDDcd088751.65E-117300528No hitNo description
SMARTSM002341.6E-40305529IPR002913START domain
PfamPF018529.2E-52306529IPR002913START domain
SuperFamilySSF559611.92E-19556793No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 799 aa     Download sequence    Send to blast
MRFGVLMIRN SVDTGGDIMH SDAIAKPLLT PTVPKSPALS LSIKGKKMDN HGDMGLLGEH  60
FDPSLVGRLK EDGYESRSGS DNLEGASGDD QEAGEDQRPR KKKYHRHTPL QIQELEVCFK  120
ECPHPDEKQR LELSRRLGLE SKQIKFWFQN RRTQMKTQLE RHENIILRQE NDKLRAENEL  180
LSQNMTDPMC NGCGGPVVPG PVSFDQQQLR IENARLKDEL GRVCALANKF LGRPLSSSAN  240
PIPPFGSNSK LELAVGRNGY GDLGNVESTF QMGLDYNDAI TMPLMKQLTG PMVSEVPYDR  300
SMMIDLAVAA MDELVKIAQI DNPLWIKSLD GGKDTLNYEE YMRTFSPCIG MKPNSFIPEA  360
TRDTGIVIIN ILALVEILMD VNRWLEAFPS LIARASTIDV ISSGMAGTKN GALQVMNAEF  420
QVVSPLVPVR QVRFLRFCKQ HSEGVWVVVD VSIDANLESS NAHPFAACRR LPSGCILQEM  480
PNGCSKVTWV EHSEYDESAV HQLYRSILSS GKGFGAQRWV ATLQRYCECM TILMSPTISG  540
EDQTVMSLSG KKSMLKLAQR MVDNFCSGVC ASSLRKWDKL LVGNIGEDVR ILTRKNINDP  600
GEPPGIVLSA ATSVWLPVMR QRLFDFLRDE RSRCEWDILS HGGMLQEMVH ISKSHSRANC  660
VSLLRSTAVS PNANDSSMLI LQETWHDVAS SLVVYAPVDI PSMSVVMNGG DSTYVALLPS  720
GFVILPDDSS SQGGSNFCNG TLVKRDSDGG DGGGCILTVG FQILVNNLPT AKLTVESVET  780
VNNLISCTIQ RIKAALQIT
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30147.m014288
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002510822.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLB9R9E70.0B9R9E7_RICCO; Homeobox protein, putative
STRINGXP_002510822.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]