PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30147.m014053
Common NameLOC8258162, RCOM_1513210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family LBD
Protein Properties Length: 284aa    MW: 32024.6 Da    PI: 6.2181
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30147.m014053genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.65.7e-40101101101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCa+Ck++rrkC+++C+lapyfp +qpk f+n+hklFG++n++k+l++l+  ++++am+s++y+A++r r Pv+G+ g+i +l+ q++q+++e+++
  30147.m014053  10 ACASCKYQRRKCSTECPLAPYFPPDQPKMFQNAHKLFGVRNITKMLETLDAPQKQEAMRSIIYQANIRERFPVHGCWGIICQLHYQIRQTEEEIHA 105
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    ++++l
  30147.m014053 106 VHAQL 110
                    99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.9449110IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-3810107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MTLKGGTSQA CASCKYQRRK CSTECPLAPY FPPDQPKMFQ NAHKLFGVRN ITKMLETLDA  60
PQKQEAMRSI IYQANIRERF PVHGCWGIIC QLHYQIRQTE EEIHAVHAQL EMYRQHHQHH  120
ISSLTDDVAS QLELGMAPPN NALSLFGHTS TPQPYNVSGM PVSQQHSYSN SSNAGYSSGY  180
LDSKDHLWVQ HPYATTNNNN TNSMAIQSQL VASQPLAIQQ VVQDYDEIHP FFDTIDDRQS  240
YIDSKEPYDS SSEESLKDTT QSIEHVAENE LKSAAACFSL TSVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2861137114LOB family transfactor Ramosa2.1
5ly0_B1e-2861137114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap30147.m014053
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002511502.10.0LOB domain-containing protein 27
SwissprotQ9STS66e-63LBD27_ARATH; LOB domain-containing protein 27
TrEMBLB9R9270.0B9R927_RICCO; LOB domain-containing protein, putative
STRINGXP_002511502.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-61LOB domain-containing protein 27
Publications ? help Back to Top
  1. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]