PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30138.m004071
Common NameLOC8263425, RCOM_1472000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Nin-like
Protein Properties Length: 312aa    MW: 35790.1 Da    PI: 5.5044
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30138.m004071genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK80.22.2e-25145194352
         RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    k ++ e +skyF++pi+ AA+eL+v+lT+LK++CR++GI+RWPhRk+ sl
  30138.m004071 145 KALTREIISKYFYMPITLAARELNVGLTLLKKRCRELGIRRWPHRKLMSL 194
                    7899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.655129214IPR003035RWP-RK domain
PfamPF020421.7E-20147194IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MASHSVLEVC SGYQIVAKEE DPSAFSSQLP TFDFCGSAYN SMLNWQNELS IQESYLDMCP  60
LMESYCPSDS LYDASLDIEH SPTIVQDDIN GLCVWSELGY LIEPQKQMLL LRESTTKESS  120
STRELKEERK ATKCREEKLN NSISKALTRE IISKYFYMPI TLAARELNVG LTLLKKRCRE  180
LGIRRWPHRK LMSLQTLIKN VQEMKKVEGD ESDKRLKEAI EILESERKLL EEMPDMQLEH  240
KTKCLRQACF KANYKKRKLM GMMGNSCSSS GSSSHASLEA SVAHEMMMMT EDDEEIKSLL  300
NEPFCHANNL MF
Cis-element ? help Back to Top
SourceLink
PlantRegMap30138.m004071
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514752.10.0protein RKD1
TrEMBLB9RLY30.0B9RLY3_RICCO; Transcription factor, putative
STRINGXP_002514752.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-54RWP-RK domain-containing protein