PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30138.m004061
Common NameRCOM_1471600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 363aa    MW: 41621.1 Da    PI: 6.5845
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30138.m004061genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.73.6e-24953145
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   kr e++snrqvt+skRrngilKKA+ELS+LCd+ + +++fs+tgk
  30138.m004061  9 KRLESTSNRQVTYSKRRNGILKKAKELSILCDIHIVLLMFSPTGK 53
                   689****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.511161IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-32160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-27295IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-19323IPR002100Transcription factor, MADS-box
PfamPF003196.2E-211156IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0055114Biological Processoxidation-reduction process
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0032440Molecular Function2-alkenal reductase [NAD(P)] activity
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGRVKLKIKR LESTSNRQVT YSKRRNGILK KAKELSILCD IHIVLLMFSP TGKPTLFHGD  60
HSNIEDVIAK FSQLTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSS QTVEELTDQV  120
RLMQAQLTEV QQRLSYWSDP DKVDRIEHLR QMEDSLKESI NQLRMHKEDI GKCQLMPLEC  180
NNQFQSGIAL PYMINGLQEA QPLSWLPNNG NQHLIISNEP SFLPQRDIEC TTNASLPGYS  240
GFYDTGKQTE IGKPGPVDNM GQEGGALRSL SSNTCLNVQL DEQFLYPPYS SLNLPDVKEV  300
KPEMQMNNQG NHTVYQVNSN FELPRPMYDN EHHTWFSASG PCSIAMFNEN PYHQNNWSSF  360
FWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-15192190MEF2 CHIMERA
6byy_B7e-15192190MEF2 CHIMERA
6byy_C7e-15192190MEF2 CHIMERA
6byy_D7e-15192190MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30138.m004061
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU8964257e-35KU896425.1 Hibiscus cannabinus microsatellite HC_ES_49_GAG sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572066.10.0agamous-like MADS-box protein AGL65 isoform X2
SwissprotQ7X9I01e-106AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLB9RLX30.0B9RLX3_RICCO; Mads box protein, putative
STRINGXP_002514742.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.11e-108AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]