PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30138.m003942
Common NameLOC8265059, RCOM_1468500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SBP
Protein Properties Length: 557aa    MW: 60183.9 Da    PI: 8.0862
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30138.m003942genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.34e-42176251277
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                    Cqv gC++dls+ keyh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  30138.m003942 176 CQVYGCNKDLSSSKEYHKRHKVCEVHSKTSKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 251
                    **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.3E-33171237IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.496173250IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-39174253IPR004333Transcription factor, SBP-box
PfamPF031105.8E-32176249IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MQSWNYVSGG KGFVSNETAS SSDSIAKSKN VLMGWDLKTA CGFGNNNVVV AGQQAIENHC  60
FGELNYQELM GKQLPDNSIR NALSSEADGG KSINHFMVNM NVFSLEHEST SRLSRTVVES  120
NSRDSSFIDL KLGRFGDPTE GHNSRISKGA SVMSSSESST PPKRLRVGVN SHPAHCQVYG  180
CNKDLSSSKE YHKRHKVCEV HSKTSKVIVN GIEQRFCQQC SRFHLLAEFD DGKRSCRKRL  240
AGHNERRRKP QVGPHSGRTG KLLQSYNGID TSRFHGTALT SFICQDILPG GPMHPKRYGT  300
DNWCRQIKVE DGYFNPLSSI PVSSGHPHSK SLFPSNNLDK VFLACHGNEA TTATGSTLSE  360
STNRYPHDLG GSISSSQSLI QDASLGQADF SAFDAASNVQ GVSGITNSGS ALSLLSSQSH  420
NLSSHSSGIS MACPLVLPGR SSHYSVSQVS EKLVGISSQA SAGAMQNKFS SSGTSSAEGS  480
RLGSILLSDG SDAINFVIAD GMYQGSNFMN AKDCLSCEDG TTIDLLQLSS QLERVERQKQ  540
SMQVKQENDA FCWPHII
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-301762491184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap30138.m003942
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514625.10.0squamosa promoter-binding-like protein 6
TrEMBLB9RLK60.0B9RLK6_RICCO; LIGULELESS1 protein, putative
STRINGXP_002514625.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-45SBP family protein