PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30138.m003866
Common NameLOC8264628, RCOM_1465160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 200aa    MW: 22905.5 Da    PI: 6.1557
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30138.m003866genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.86.5e-1584141562
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                    +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN+ L+++l++ ++  +++ +e
  30138.m003866  84 RKQRRMISNRESARRSRMRKQKHLDELWSQVVRLRTENHNLIDKLNHVSECHDRVLQE 141
                    79********************************************999877666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.1E-1680144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.58882133IPR004827Basic-leucine zipper domain
PfamPF001709.2E-1384142IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.25E-1384133No hitNo description
Gene3DG3DSA:1.20.5.1704.6E-1384157No hitNo description
CDDcd147025.80E-2085136No hitNo description
PROSITE patternPS00036087102IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MLPGELTGIQ YLAPENPIPF SANLGLMQQT SMPTFHYNRL ISNFYSNPSF PQPVQDFTQQ  60
SSSLSNNSTS DEAEENQLSI IDERKQRRMI SNRESARRSR MRKQKHLDEL WSQVVRLRTE  120
NHNLIDKLNH VSECHDRVLQ ENARLKEEAS DLRQMLTDLQ IGSPFTASAL RDLEDVPCNT  180
AHLRAESSNQ SISSSVDLLH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
196103RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30138.m003866
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514552.11e-146basic leucine zipper 43
SwissprotQ9FMC21e-40BZP43_ARATH; Basic leucine zipper 43
TrEMBLB9RLD31e-145B9RLD3_RICCO; Ocs element-binding factor, putative
STRINGXP_002514552.11e-146(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.11e-45basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]