PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30131.m007120
Common NameLOC8284362, RCOM_1450040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GATA
Protein Properties Length: 368aa    MW: 40833.9 Da    PI: 4.756
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30131.m007120genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.63.5e-18287320134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  30131.m007120 287 CSHCQVQKTPQWRTGPLGAKTLCNACGVRYKSGR 320
                    *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.385281317IPR000679Zinc finger, GATA-type
SMARTSM004017.6E-14281335IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.05E-13284344No hitNo description
Gene3DG3DSA:3.30.50.102.0E-14285318IPR013088Zinc finger, NHR/GATA-type
CDDcd002028.35E-14286343No hitNo description
PROSITE patternPS003440287312IPR000679Zinc finger, GATA-type
PfamPF003204.8E-16287320IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MEYCMAARAL KSSLRSDMMK SSTTTTTQQF FFDDMFSNSN NTVVEDFSVD CFFDFSNGGE  60
FKDSGSTAAF NNNVQEQQQQ QQHMIDAVEE EEDDDDDEEE EEEKDSLSVS SQDRSGVDDD  120
NNSNSSTFDE SFLTSELAVP IEDLAELEWV SQFVDDSSPE FSLLYPLNSE DHHTRNRFQP  180
EHPKPVALTK PSCLFPVKIP AKPRSKRTRP TGRTWSVESL LTDSSSSSSS YCSSSPISSS  240
ASTPCFVTVQ TIDSLPSFCE PPAKKAKRKP AAQTGGATGL TQFQRRCSHC QVQKTPQWRT  300
GPLGAKTLCN ACGVRYKSGR LFPEYRPACS PTFSGDIHSN SHRKVLEIRK KKELSGPASG  360
LSQMVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512985.10.0PREDICTED: GATA transcription factor 5
TrEMBLB9RHC60.0B9RHC6_RICCO; GATA transcription factor, putative
STRINGPOPTR_0009s12620.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-49GATA transcription factor 5