PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30099.m001671
Common NameRCOM_1382320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 226aa    MW: 25589.5 Da    PI: 8.6033
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30099.m001671genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.37.4e-223582249
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                   +i+ k+  qvtfskRr+g++KKA+EL++LC++e+a+++fs+ +k + +
  30099.m001671 35 KISKKTHLQVTFSKRRAGLFKKASELCTLCGVEIAILVFSPANKAFSF 82
                   799**************************************9997766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.3382686IPR002100Transcription factor, MADS-box
SMARTSM004324.5E-312685IPR002100Transcription factor, MADS-box
CDDcd002652.15E-332795No hitNo description
SuperFamilySSF554551.02E-2627112IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-172848IPR002100Transcription factor, MADS-box
PfamPF003191.3E-233582IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-174863IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-176384IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MLAPRNTKVI DYFFLSFNNG EERVYLGRQK IAIEKISKKT HLQVTFSKRR AGLFKKASEL  60
CTLCGVEIAI LVFSPANKAF SFGHPEVESV LDRFLARHPL PTSSSAHQLI EAHRNANVCE  120
LNMQLTHTLN QMEDEKKKGE LLDQIRKSSQ NMCWWEAPID ELGMHELEQL RFALEELKKN  180
VTKQISKILI NSGSSLPFSS GNVIGHISDY ESKPNVAPCI PCVNKH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A4e-1526112187MEF2C
5f28_B4e-1526112187MEF2C
5f28_C4e-1526112187MEF2C
5f28_D4e-1526112187MEF2C
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. {ECO:0000269|PubMed:18599653, ECO:0000269|PubMed:18713950}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30099.m001671
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002522084.21e-163agamous-like MADS-box protein AGL61
SwissprotQ4PSU42e-58AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLB9S7W81e-167B9S7W8_RICCO; Mads box protein, putative
STRINGXP_002522084.11e-168(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.17e-61AGAMOUS-like 61
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]