PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30076.m004464
Common NameLOC8270765, RCOM_1340450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family MYB_related
Protein Properties Length: 768aa    MW: 83834.1 Da    PI: 6.5479
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30076.m004464genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.54.7e-162569147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
    30076.m004464 25 RERWTEEEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 69
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.28E-171975IPR009057Homeodomain-like
PROSITE profilePS5129421.0912074IPR017930Myb domain
TIGRFAMsTIGR015578.4E-172372IPR006447Myb domain, plants
SMARTSM007177.3E-132472IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-82565IPR009057Homeodomain-like
PfamPF002493.2E-132568IPR001005SANT/Myb domain
CDDcd001671.49E-92770No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MDTYSSGGED LVIKTRKPYT ITKQRERWTE EEHNRFLEAL KLYGRAWQRI EEHIGTKTAV  60
QIRSHAQKFF SKLEKEAIAK GVPIGQALDI DIPPPRPKRK PSNPYPRKTG AGPTPSQVAA  120
KDGKLPSLVS FPRCTQVLDL EKEPLPERLN GHEKQTDATE NQGDNCSEVF TLLQEAHCSS  180
VSSANKNSVV TAEALKNSCS FREFVPSLKK VVNQDATNES YVTIELEGNQ KLDKPDAKQT  240
VQDNGSSKAS KSESCLFHEK FDQAKKSDEF NSALPTDEME TMQGYPRHVP VHVLEGSLGT  300
CMQTPTSDVS FQEPIFCPTG EVHGHPNLYS HPAASATTEH QNTAPRSSTH QSFPSFPPFN  360
STQHNQDDYR SFLHISSTFS SLIVSTLLQN PAAHSAASFA ATFWPYANLE SSADSPICPQ  420
GGFPSRQMNS APSMAAIAAA TVAAATAWWA AHGLLPLCAP LHAAFTCPPA SGTAVASTGA  480
GQVPAAKTER KLTVENPLLQ NQQFDVEHSK VLQAQNSASK SLEMSLSDSE ESGGPKKNTG  540
SKATDHEMAT PAPEVQDPSK AKARKPADRS SCGSNTSSSS EVETDALEKL EKGNEELKET  600
DTNPEPTESS CRRSRSNSSI SDSWKEVSEE GRLAFQALFS REVLPQSFSP PHVLKNEARQ  660
KDEIEEDKQN TVEKNENALL LSLNGNISGF CTSHQEAEKI EMPRCENNGE DGLLTFGLGH  720
GKLKARRTGF KPYKRCSVEA KENRMLTAGS QGEEKGPKRI RVEGKAST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00103PBMTransfer from AT2G46830Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap30076.m004464
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002515093.10.0protein LHY isoform X1
RefseqXP_015572367.10.0protein LHY isoform X1
TrEMBLB9RMV40.0B9RMV4_RICCO; Uncharacterized protein
STRINGXP_002515093.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-81circadian clock associated 1