PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30074.m001414
Common NameRCOM_1333830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7149.34 Da    PI: 8.7839
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30074.m001414genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.16.4e-15445142
                   S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
         SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                   ++i n s r  tf +Rr+g+lKK +EL +LC++ ++ iifs 
  30074.m001414  4 EFITNVSVRRMTFRQRRAGLLKKLKELATLCGIVACAIIFSA 45
                   6899************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-11155IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.526144IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.62E-15258IPR002100Transcription factor, MADS-box
CDDcd002664.28E-18456No hitNo description
PfamPF003197.0E-14545IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MKHEFITNVS VRRMTFRQRR AGLLKKLKEL ATLCGIVACA IIFSAYDSSP DVWPSPAEAF  60
DDF
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the development of gametophytes and seeds. {ECO:0000269|PubMed:12815071}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30074.m001414
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by MEA, FIS2 and FIE in seeds, and by PKL after germination. {ECO:0000269|PubMed:12815071, ECO:0000269|PubMed:16359393}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376234.16e-28agamous-like MADS-box protein AGL80
SwissprotO808055e-15PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBLB9S7511e-39B9S751_RICCO; Mads box protein, putative
STRINGXP_002521820.12e-40(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144641115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.23e-20M-type_MADS family protein
Publications ? help Back to Top
  1. Raissig MT,Bemer M,Baroux C,Grossniklaus U
    Genomic imprinting in the Arabidopsis embryo is partly regulated by PRC2.
    PLoS Genet., 2013. 9(12): p. e1003862
    [PMID:24339783]
  2. Jeong CW, et al.
    Control of Paternally Expressed Imprinted UPWARD CURLY LEAF1, a Gene Encoding an F-Box Protein That Regulates CURLY LEAF Polycomb Protein, in the Arabidopsis Endosperm.
    PLoS ONE, 2015. 10(2): p. e0117431
    [PMID:25689861]
  3. Burkart-Waco D,Ngo K,Lieberman M,Comai L
    Perturbation of parentally biased gene expression during interspecific hybridization.
    PLoS ONE, 2015. 10(2): p. e0117293
    [PMID:25719202]
  4. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]