PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30055.m001548
Common NameLOC8271906, RCOM_1280780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 358aa    MW: 40097.6 Da    PI: 9.3629
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30055.m001548genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.72.5e-13276326555
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                    +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN +Lk  +ee++++
  30055.m001548 276 RRQRRMIKNRESAARSRARKQAYTVELELELNQLKEENAKLKLLVEEIEQN 326
                    69************************************9888666666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-10272333IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.128274326IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.7E-13275326No hitNo description
SuperFamilySSF579593.38E-10276325No hitNo description
PfamPF001701.7E-11276327IPR004827Basic-leucine zipper domain
CDDcd147072.52E-24276323No hitNo description
PROSITE patternPS000360279294IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MVLSESDTIV YGSITKSNSP PLSHPQSHLQ DESMKDASFS PLSGQNSLLS LTLNEIQHKS  60
GKSFGSMNMD EFLANLWSSV EENQVTPQPN QLQHAKDNGS VINLPPLARQ GSFSIPAPLC  120
KKTVDEVWFE IQKEQPERQK PSNIDAREPP QRQQTLGEMT LEDFLVKAGV VQEATQSAGS  180
SLQKMVTPIQ NINACLDASF GMGQVMGMGF PTAHQTIGNS FSTGNGFAPY QMFPQSKGFI  240
GEAPNNAKTE QGQTELGMQQ NKKRIIDGPP EVVVERRQRR MIKNRESAAR SRARKQAYTV  300
ELELELNQLK EENAKLKLLV EEIEQNRKEE VLRRKPLIMP KKKVDKLRSI RRTVSLTW
Functional Description ? help Back to Top
Source Description
UniProtCould participate in abscisic acid-regulated gene expression during seed development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap30055.m001548
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015577682.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform X1
RefseqXP_015577683.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform X1
SwissprotQ8RYD62e-80AI5L1_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 1
TrEMBLB9SCS50.0B9SCS5_RICCO; Uncharacterized protein
STRINGXP_002523794.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.13e-59bZIP family protein