PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30005.m001260
Common NameRCOM_1211780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 533aa    MW: 59267.8 Da    PI: 4.2749
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30005.m001260genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.41.6e-08277335563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    k+++r + NR++A +  ++Kk +i  Le+k+++L +e+ aLk  l  l+ e++ l +e+
  30005.m001260 277 KKAKRIIANRTSAVKAKEKKKLYICMLEDKIQSLNSERAALKAHLTLLQTESKGLNAEN 335
                    99***********************************************9999888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.5E-8273337IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.519275338IPR004827Basic-leucine zipper domain
PfamPF077167.1E-7275327IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.8E-8277332No hitNo description
SuperFamilySSF579597.72E-8277330No hitNo description
CDDcd147034.91E-16278327No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MEKDKGKRAM YEAEDVDLLK LLMDHGNQPD VSSPFQPLSP LWARNPTQNS LLTNYAGEAI  60
LLQGSSSSSS SKEDTVLEEQ EKLEDADADD FFFKLLTMST DDSVLHLAAA GSSNPPVTKN  120
VSDGGILLIN QPDVSSPFQP LSPLWATQNG LLTNNSGETI LLQGSSSSSS GSPSSKQDSA  180
LGEQEKLEGA DDDDFFFKLL TMSTEDSVLA DESFKPPATE NVADDDMDLR IVAPPEVAVH  240
PPAIAAPAAT NRSALRRAKG KVMSTQEIEE LAMQDPKKAK RIIANRTSAV KAKEKKKLYI  300
CMLEDKIQSL NSERAALKAH LTLLQTESKG LNAENVKLKE QTDLVLHQLH FQESLNEEVR  360
NEIMQLRTLT QMIPRNEMML NNNGDSTNNN NSTDLAMDQA SLPLGREEFL HLQNQVPYPY  420
QMDQLQNGVE QMNLGQQYYP WQVQPDHPQT QQATPYQDLM QQQPQSQEQN HHLQYQLEEL  480
LPYDYLQQHQ EVSPFSDQEP VIAQDPNNIA NPPPYSSDDK ESNDNYCSLG GVS
Cis-element ? help Back to Top
SourceLink
PlantRegMap30005.m001260
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLB9SF070.0B9SF07_RICCO; Uncharacterized protein
STRINGXP_002524576.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3727922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.13e-25bZIP family protein