PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29992.m001406
Common NameLOC8270280, RCOM_1187310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family NAC
Protein Properties Length: 213aa    MW: 24264 Da    PI: 4.3246
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29992.m001406genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM96.34.5e-3091291128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                    lppGfrF Ptdeelv+++L +k++ ++    + i+e+  +  +Pw+L+ k+ ++ ++wyfF++++       ++++ t++g+Wk+   ++++ls  
  29992.m001406   9 LPPGFRFCPTDEELVSHFLYPKASLSSSCS-NLIPEL-FLPPDPWKLHGKALSSGNQWYFFTQKKIM-----QSHQETENGFWKHLDIEEPILSDA 97 
                    79*********************9999555.789997.6678*****977778899******98775.....45667999**************** PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    g+++glkk  ++y g++p++ +t+W+m+ey+l
  29992.m001406  98 GTKIGLKKLVMYYIGQHPTAIETSWMMQEYHL 129
                    *******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-356163IPR003441NAC domain
PROSITE profilePS5100535.179163IPR003441NAC domain
PfamPF023653.4E-2110129IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MGDCSRLNLP PGFRFCPTDE ELVSHFLYPK ASLSSSCSNL IPELFLPPDP WKLHGKALSS  60
GNQWYFFTQK KIMQSHQETE NGFWKHLDIE EPILSDAGTK IGLKKLVMYY IGQHPTAIET  120
SWMMQEYHLS KSSTSSLFAD ISCKRNRNSL DCHERVLCRV YQRKESSQSL SCTDDEDDDG  180
DGDDDDGTEL SCLDEVFLSL EDDVDDDLCF LPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-28516813170NO APICAL MERISTEM PROTEIN
1ut4_B2e-28516813170NO APICAL MERISTEM PROTEIN
1ut7_A2e-28516813170NO APICAL MERISTEM PROTEIN
1ut7_B2e-28516813170NO APICAL MERISTEM PROTEIN
3swm_A2e-28516816173NAC domain-containing protein 19
3swm_B2e-28516816173NAC domain-containing protein 19
3swm_C2e-28516816173NAC domain-containing protein 19
3swm_D2e-28516816173NAC domain-containing protein 19
3swp_A2e-28516816173NAC domain-containing protein 19
3swp_B2e-28516816173NAC domain-containing protein 19
3swp_C2e-28516816173NAC domain-containing protein 19
3swp_D2e-28516816173NAC domain-containing protein 19
4dul_A2e-28516813170NAC domain-containing protein 19
4dul_B2e-28516813170NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap29992.m001406
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002516299.11e-157NAC domain-containing protein 104
TrEMBLB9RRD01e-156B9RRD0_RICCO; NAC domain-containing protein, putative
STRINGXP_002516299.11e-157(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.11e-39xylem NAC domain 1