PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29940.m000398
Common NameLOC8277877, RCOM_1105770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 702aa    MW: 76122.9 Da    PI: 6.9804
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29940.m000398genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.61.6e-14206267263
                    XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                    ++ kr  r+++NRe+A+ sRqRKk ++eeLe+kvk++ +   +L ++++    e a+l++++
  29940.m000398 206 EDEKRKARLMRNRESAQLSRQRKKHYVEELEDKVKTMHSTIADLNSKISFFMAENATLRQQL 267
                    6789*********************************************9999999999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-18205269IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.473207267IPR004827Basic-leucine zipper domain
PfamPF001705.3E-13208267IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-18209268No hitNo description
SuperFamilySSF579591.31E-12209267No hitNo description
CDDcd147041.62E-21210261No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042538Biological Processhyperosmotic salinity response
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005783Cellular Componentendoplasmic reticulum
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MGDAILSDHP PLDSSNYSTD DFDSLAIPPL DPMFLSEQSS GENYNLVSDL QFSLDDNYDF  60
DITFDDLVDF NLPSDNDHDH GHDRFSIDPK SASPELGISG DHHVATYLNS SPSASNSTTT  120
CSSGDQLNVS SPVSSQGSGN GGSGVSDSVN FVVDQKVKLE EEGSNSKNKN GSLSKRKKEN  180
GSEDTRNQKY RRSENSNANT QCVSDEDEKR KARLMRNRES AQLSRQRKKH YVEELEDKVK  240
TMHSTIADLN SKISFFMAEN ATLRQQLSGG NGMCPPPMYA PMPYPWVPCA PYVVKAQGSQ  300
VPLVPIPRLK SQQPVSAAKS KKSDPKKAEG KTKKVASVSF LGLLFFVLLF GGLVPIVNVK  360
FGGVGENGAN GFVSDKFYNR HRGRVLRVDG HSNGSHENVD VGFSTGDFDS CFRIQCGSGR  420
NGCLAEKKGR LEHLPEADEL VRRGNNSKPL AASLYVPRND KLVKIDGNLI IHSVLASERA  480
MSSNENPEAN KSKETGLAIP RDLSPSPTIP GRYSHLYGHH NERQKALTSG SSDTLNDHKK  540
SAAADGKLQQ WFHEGLAGPL LSSGMCSEVF QFDALPTPGA IIPASSVSNI TAEGQQNATN  600
HKKGKNRRIL HGLPIPLTGS DLNITGEHVG NSQKENFQGN KSVSPMVVSV LVDPREAGDI  660
EVDGVIAPKS ISRIFVVVLL DSVKYVTYSC VLPRSGPQLV TT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator involved in salt and osmotic stress responses. Functions as a stress sensor and transducer in a signaling pathway that resembles an ER stress response. Following salt stress, BZIP17 is cleaved by SBT6.1 (S1P) and S2P at the C-terminus and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression of salt stress response genes (PubMed:17662035). Functions as a stress sensor and transducer in ER stress signaling pathway. ER stress induces proteolysis of BZIP17 by SBT6.1 (S1P) and S2P, and the N-terminal bZIP component is translocated to the nucleus, where it activates the expression and production of ER chaperones, as well as protein involved in brassinosteroid (BR) signaling, which is required for stress acclimation and growth (PubMed:20876872). {ECO:0000269|PubMed:17662035, ECO:0000269|PubMed:20876872}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29940.m000398
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526200.10.0bZIP transcription factor 17
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLB9SJN10.0B9SJN1_RICCO; Transcription factor hy5, putative
STRINGXP_002526200.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74873448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.11e-162bZIP family protein
Publications ? help Back to Top
  1. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]
  2. Sagor GH, et al.
    The polyamine spermine induces the unfolded protein response via the MAPK cascade in Arabidopsis.
    Front Plant Sci, 2015. 6: p. 687
    [PMID:26442007]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Kim JS,Yamaguchi-Shinozaki K,Shinozaki K
    ER-Anchored Transcription Factors bZIP17 and bZIP28 Regulate Root Elongation.
    Plant Physiol., 2018. 176(3): p. 2221-2230
    [PMID:29367234]
  5. Cifuentes-Esquivel N, et al.
    bZIP17 regulates the expression of genes related to seed storage and germination, reducing seed susceptibility to osmotic stress.
    J. Cell. Biochem., 2018. 119(8): p. 6857-6868
    [PMID:29693271]
  6. Guan P, et al.
    SENSITIVE TO SALT1, An Endoplasmic Reticulum-Localized Chaperone, Positively Regulates Salt Resistance.
    Plant Physiol., 2018. 178(3): p. 1390-1405
    [PMID:30287478]