PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29929.m004544
Common NameLOC8274251, RCOM_1077600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 237aa    MW: 26715.2 Da    PI: 8.003
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29929.m004544genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.33.1e-16445950
                   HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
         SRF-TF  9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                   ++  + +R++++ KKAeELS+LCd+ va++ + ++gk+ +++
  29929.m004544  4 NKAVYKNRKATLKKKAEELSILCDVPVALVCYDPDGKVDTWP 45
                   566799***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006611.297148IPR002100Transcription factor, MADS-box
PfamPF003196.4E-14544IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.49E-15568IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-51025IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-52546IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MSLNKAVYKN RKATLKKKAE ELSILCDVPV ALVCYDPDGK VDTWPEDKSK VDEILTEFAR  60
KQNLKLPSSE TTAKNKNGNQ DLQVMENGNI LDEEKKKKRK NAVKKVYKTW DERFDYLPEE  120
DLIEILEVIE SKEKSLAQRV KAEEVGKKRK GTQVDDDDDG LVTLRLGRYD YSASSSSSGN  180
LTKDKGKCSI ESSSNGSDFR HGIAKGIGDL GVQLEESRKV TEAVPITMPQ KTIQFYF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19499KKKKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMap29929.m004544
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514809.11e-173agamous-like MADS-box protein AGL103
TrEMBLB9RM401e-171B9RM40_RICCO; Mads box protein, putative
STRINGXP_002514809.11e-172(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1711348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.12e-11AGAMOUS-like 103