PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29927.m000626
Common NameLOC8270224, RCOM_1075820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family YABBY
Protein Properties Length: 185aa    MW: 20966.8 Da    PI: 8.2267
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29927.m000626genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY197.55.8e-6171595170
          YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssek 100
                      +eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ ++              +  ++n   + ++  s+s+ ++  +
  29927.m000626   7 VVPEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDF-------------QAPSHNSPDYRIELGSSSKCNNRIS 89 
                    679********************************************99999988884.............2222222333333333333333344 PP

          YABBY 101 lsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                    +     +++++   v+rPPekrqrvPsayn+fikeeiqrika+nP+ishreafs+aaknWah+P+ihfgl
  29927.m000626  90 MRAPAPHNIAEERVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPEISHREAFSTAAKNWAHYPHIHFGL 159
                    455556666666679*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.5E-699159IPR006780YABBY protein
SuperFamilySSF470951.24E-7104152IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.3E-4107152IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MSSCVDVVPE QLCYIPCNFC NIVLAVSVPC SSLFDIVTVR CGHCTNLWSV NMAAAFQSLS  60
WQDFQAPSHN SPDYRIELGS SSKCNNRISM RAPAPHNIAE ERVVNRPPEK RQRVPSAYNQ  120
FIKEEIQRIK ANNPEISHRE AFSTAAKNWA HYPHIHFGLT LNNHQTKLDD ASEKHLMSRA  180
ALYNK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002527201.11e-138PREDICTED: axial regulator YABBY 5
SwissprotQ8GW462e-83YAB5_ARATH; Axial regulator YABBY 5
TrEMBLB9SMI21e-137B9SMI2_RICCO; Axial regulator YABBY5, putative
STRINGVIT_11s0016g05590.t011e-116(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.21e-84YABBY family protein