PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29912.m005524
Common NameLOC8268851, RCOM_1052790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 338aa    MW: 38880.4 Da    PI: 9.6464
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29912.m005524genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.74e-151051243
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                    i+n+  r +t+ kR++g+ KK +E  +LCd+++++iifs++
  29912.m005524 10 LISNEKSRMITYHKRKKGLTKKVQEFHILCDVDACIIIFSPK 51
                   59**************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006618.754161IPR002100Transcription factor, MADS-box
SMARTSM004328.3E-16164IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-20282IPR002100Transcription factor, MADS-box
CDDcd001201.44E-19264No hitNo description
PRINTSPR004041.5E-11323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-112338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-113859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRGKLNMEL ISNEKSRMIT YHKRKKGLTK KVQEFHILCD VDACIIIFSP KFNNRSFDIE  60
TWPSNRYEMR RIINRYRSQD NDRKRNQDLS HFFIARKKKI DEDIAKMRKA HMEAKYPAWD  120
NRINLLQLHE LSVLASVLQS KIEVATARVM KIRGESDHYF MVDSKSGIIH GGPISHNIRP  180
NPMAATFANA LVQKSLELEA FNNKQQPFYC TSQFDHPTSS HNQMLPALNV NNPTNSSTLM  240
TMMMANGDDL NQFSGECSSE RACSIIKDVT YFDPPTTHHQ LVGNMMISPR AHPVSSSGLN  300
RQLPMLPYRQ DSALMPNASS HQLRTPPFSE FCDFNERQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18298RKRNQDLSHFFIARKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMap29912.m005524
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002514306.10.0floral homeotic protein PISTILLATA
TrEMBLB9RKR20.0B9RKR2_RICCO; Mads box protein, putative
STRINGXP_002514306.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.14e-23M-type_MADS family protein