PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29900.m001555
Common NameLOC8259173, RCOM_1012260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WOX
Protein Properties Length: 390aa    MW: 42991.9 Da    PI: 8.0599
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29900.m001555genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.87.8e-1857117257
                    T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                    ++R+++++eq+++Le+ F++   +p ++e++++ ++l    ++ +++V++WFqNr+ + k+
  29900.m001555  57 KPRWNPKPEQIRILEAIFNSgMVNPPRDEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 117
                    89*****************99*************************************995 PP

2Wus_type_Homeobox112.22.8e-3656118264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P+++ei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
      29900.m001555  56 PKPRWNPKPEQIRILEAIFNSGMVNPPRDEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 118
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.17E-1252121IPR009057Homeodomain-like
PROSITE profilePS5007110.51153118IPR001356Homeobox domain
SMARTSM003891.4E-855122IPR001356Homeobox domain
CDDcd000861.11E-856118No hitNo description
Gene3DG3DSA:1.10.10.608.3E-756117IPR009057Homeodomain-like
PfamPF000462.1E-1557117IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTH HQQWQHEMNS SSLASTGCHR TPYASVPGCE ERSPEPKPRW  60
NPKPEQIRIL EAIFNSGMVN PPRDEIRKIR AQLQEYGQVG DANVFYWFQN RKSRSKHKLR  120
LLQNSSKQHN SQQQQQTHQT TSPITPSITS LTAPSPSSSS SSEKCSPKCS KKTISLSSQS  180
VVDVSNSSTG SVNQTYFQQH NEFMPEPFFF PIQQTTTGAG GGTGSFTQGL CFQDNNAAGP  240
CTSLLLSEIM SCDASKKDLH HDDKNMKMQS YLSYPVSTTP ITHSNTRLAP PLPFPATDTN  300
TVAVASSMNL INHGVGESSG AVARSTVFIN DVPFEVGVGP FNVREAFGDD FILIHSSGHP  360
VLTNDWGLTL HSLQHGASYY LVPFSMSENI
Cis-element ? help Back to Top
SourceLink
PlantRegMap29900.m001555
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002522513.10.0WUSCHEL-related homeobox 9
TrEMBLB9S9440.0B9S944_RICCO; Uncharacterized protein
STRINGXP_002522513.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.13e-62homeobox-3