PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29887.m000236
Common NameRCOM_0996790
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family B3
Protein Properties Length: 219aa    MW: 24887.6 Da    PI: 10.322
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29887.m000236genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B351.91.4e-16121216199
                    EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                    f ++   s+ ++  r+ +p kf+ ++ ++++e+++       +r+W vk+i + ++gr  +++GW  F++ n L++gD+++F+l++ ++   +v++
  29887.m000236 121 FMSTIQASHIHRDYRMHVPVKFMVKCTKQSRENVM---LIVGNRQWPVKMISSTSDGRSKFSAGWLAFARGNSLQVGDICIFELIDGETVLIKVSI 213
                    55666778888999************877666533...44567******************************************88888799999 PP

                    E-S CS
             B3  97 frk 99 
                    fr+
  29887.m000236 214 FRH 216
                    986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.105.1E-22114216IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.35E-20116215IPR015300DNA-binding pseudobarrel domain
CDDcd100171.02E-22119215No hitNo description
SMARTSM010197.1E-12120217IPR003340B3 DNA binding domain
PROSITE profilePS5086312.59121217IPR003340B3 DNA binding domain
PfamPF023626.1E-14121216IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MHRFFKIILG DTLRDDFHDP IQETENAASV KTSSHSLPCL KSKETPPLPF PQPHKSMKLE  60
NPTPNINPQS VAGKVEENEN MDSQKQRLNG TVSRKRSQFK EAKATAIQRA SIKYESKNPF  120
FMSTIQASHI HRDYRMHVPV KFMVKCTKQS RENVMLIVGN RQWPVKMISS TSDGRSKFSA  180
GWLAFARGNS LQVGDICIFE LIDGETVLIK VSIFRHVTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A5e-189321522141B3 domain-containing transcription factor VRN1
4i1k_B5e-189321522141B3 domain-containing transcription factor VRN1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap29887.m000236
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025015420.16e-99B3 domain-containing transcription factor VRN1-like
TrEMBLB9T2301e-163B9T230_RICCO; Uncharacterized protein
STRINGXP_002532299.11e-164(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49480.15e-22related to vernalization1 1