PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29876.m000245
Common NameLOC8269403, RCOM_0982120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family WOX
Protein Properties Length: 268aa    MW: 30499.9 Da    PI: 7.8052
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29876.m000245genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.12e-202281357
                   --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
       Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                   +R+++tkeq+  Le+++++  r+p+ae++++++++l    +++ ++V++WFqN++a++++
  29876.m000245 22 SRWNPTKEQIGLLENMYRQgIRTPTAEQIQQITTRLrdygHIEGKNVFYWFQNHKARQRQ 81
                   7*****************99**************************************96 PP

2Wus_type_Homeobox113.88.5e-372083265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi +Le++y++G+rtP++e+iq+it++L+ yG+ie+kNVfyWFQN+kaR+rqkq
      29876.m000245 20 VNSRWNPTKEQIGLLENMYRQGIRTPTAEQIQQITTRLRDYGHIEGKNVFYWFQNHKARQRQKQ 83
                       679***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.1751782IPR001356Homeobox domain
SuperFamilySSF466898.76E-131887IPR009057Homeodomain-like
SMARTSM003897.7E-41986IPR001356Homeobox domain
PfamPF000465.0E-182281IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.3E-82281IPR009057Homeodomain-like
CDDcd000869.79E-62383No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MESENIDTGN SGDGTGAHQV NSRWNPTKEQ IGLLENMYRQ GIRTPTAEQI QQITTRLRDY  60
GHIEGKNVFY WFQNHKARQR QKQKQENIAY INRYLHKAHH PPVFAPPCPN VVCGSYYLPQ  120
SDLGFCPQYP RLLLPAGNFK RRPRTEKIIE KARSCAVPQE YNNIMIQTND RNINQGRIHS  180
KSYISNQETL PLFPLHPTGI LQGRETSITV CSLGSTNNSA EDSINATSTP SSYSSDETNT  240
GVKDCCNDKP FFDFFSEQGD DQGRIERD
Cis-element ? help Back to Top
SourceLink
PlantRegMap29876.m000245
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002531361.10.0WUSCHEL-related homeobox 2
TrEMBLB9SZE20.0B9SZE2_RICCO; Transcription factor, putative
STRINGXP_002531361.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.14e-53WUSCHEL related homeobox 2