PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29863.m001047
Common NameRCOM_0959200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 299aa    MW: 32457.2 Da    PI: 4.7717
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29863.m001047genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_145.41.8e-14242291352
                    XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                    + +r+rr++kNRe+A rsR+RK+a++ eLe  +  Le+eN+++ ke  +l
  29863.m001047 242 AQQRQRRMIKNRESAARSRERKQAYQVELESLAVRLEEENEQMLKEKVNL 291
                    679**************************************999886665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000411.8E-5172187IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.8E-5239255IPR001630cAMP response element binding (CREB) protein
SMARTSM003381.1E-5240293IPR004827Basic-leucine zipper domain
PfamPF001704.7E-13242292IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.3242292IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.69E-9244292No hitNo description
CDDcd147073.89E-17244291No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-12245293No hitNo description
PROSITE patternPS000360247262IPR004827Basic-leucine zipper domain
PRINTSPR000411.8E-5257277IPR001630cAMP response element binding (CREB) protein
PRINTSPR000411.8E-5277294IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MASSKVMASS KPKSSDLTAP TTRSRRPSSS SSSDQVKNLS YNFNSTTTAA SLVTPSSSTM  60
TVDGIIRSSN NNNSNIYSTP APIPTTADST LLDAQITLID NPTPPPPPQM ETSTAAISQS  120
NKTVDDVWRE IVSGRKEMKE EQPDEMMTLE DFLAKAGAVD VVEDEDLDDE VKMPLPLPSP  180
LSSGGMYAFD SPVSVPQASN AFQILDKVEG SIVAFGNGGN TGGGGRGKRG RSVVMEPLDK  240
AAQQRQRRMI KNRESAARSR ERKQAYQVEL ESLAVRLEEE NEQMLKEKVN LNSFNCFRD
Functional Description ? help Back to Top
Source Description
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29863.m001047
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002524291.20.0G-box-binding factor 4
SwissprotP427772e-49GBF4_ARATH; G-box-binding factor 4
TrEMBLB9SE720.0B9SE72_RICCO; Transcription factor, putative
STRINGXP_002524291.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20283481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.14e-51bZIP family protein