PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29851.m002491
Common NameLOC8275548, RCOM_0939100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family B3
Protein Properties Length: 545aa    MW: 62726.9 Da    PI: 8.5457
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29851.m002491genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.54.8e-1329118197
                    EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
             B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                    ffk+ +ps+ +  + l++p kf++++g++   s    + +++ r W+v l  rk  + +++ +GW +Fvk + ++ g  +vF + g s+f   v +
  29851.m002491  29 FFKIILPSNLNDMK-LRIPTKFVRNFGNE--LSDVANFITPNCRLWKVGL--RKVHNDIWFDDGWHDFVKHHSICIGYLLVFGYRGFSDF--SVFI 117
                    78888777666665.********888744..7889***************..*******************************9876888..5555 PP

                    E CS
             B3  97 f 97 
                    f
  29851.m002491 118 F 118
                    5 PP

2B353.93.3e-17320396888
                    -HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
             B3   8 sdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                    +++  ++ l++p+ f e++ ++   +  l+le ++gr+W+v++  rk+ +r  l++G   F ++n+Lk+gD+++F+l++++
  29851.m002491 320 PYNCCNNVLYVPRGFSEKYLSE--APNYLILEVSDGREWQVRV--RKNCRRLDLGRGLTAFFRDNNLKAGDVCIFELIKNT 396
                    56677889***********655..4558***************..********************************9863 PP

3B357.62.3e-18450535797
                    .-HHHHTT-EE--HHH.HTT..---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
             B3   7 psdvlksgrlvlpkkfaeeh..ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                    ++++   + l++p+ f + +      ++   ++++ ++gr+W++ l  +k+ ++ v++ GWkeF+k+n+Lk+gD++vF+l+  +++ l+ ++f
  29851.m002491 450 RPYNCYDHGLSVPRIFSKWYlwR--ARK--CIKVKVSDGREWTICL--QKSCKHLVFQMGWKEFCKDNNLKAGDVCVFELIT-KNRVLKASIF 535
                    566667788*******9999553..334..48888999********..*******************************996.5554565555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.2E-2023123IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019367.06E-2125128IPR015300DNA-binding pseudobarrel domain
CDDcd100171.85E-1227119No hitNo description
PROSITE profilePS5086311.12428121IPR003340B3 DNA binding domain
PfamPF023621.1E-929117IPR003340B3 DNA binding domain
SMARTSM010199.2E-929121IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.9E-22306399IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.75E-20307397IPR015300DNA-binding pseudobarrel domain
CDDcd100172.55E-15312404No hitNo description
PROSITE profilePS5086312.351313407IPR003340B3 DNA binding domain
SMARTSM010191.2E-9314407IPR003340B3 DNA binding domain
PfamPF023621.9E-15320397IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.5E-25437538IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.22E-21438537IPR015300DNA-binding pseudobarrel domain
CDDcd100171.06E-17443535No hitNo description
PROSITE profilePS5086313.775444538IPR003340B3 DNA binding domain
SMARTSM010193.9E-10445538IPR003340B3 DNA binding domain
PfamPF023625.1E-17447536IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MALHREMKSN GDDRRRLPHS PAEKPLRHFF KIILPSNLND MKLRIPTKFV RNFGNELSDV  60
ANFITPNCRL WKVGLRKVHN DIWFDDGWHD FVKHHSICIG YLLVFGYRGF SDFSVFIFDV  120
SACEIEYPCN DQGLVHGEKC RIQNQVEVED DNPTDVFGSG ILSPSCSSLK SKVCDASASK  180
EEPSKEVAPA EQNLGMKKRS RVVVLGGHPY LKRNYETRSK KVKVEQLDQL TNIDANESRK  240
GTLDRYEMSW SHEVNELQDR SRSRVKSGEN QLLPRCEEDI EIITSEMFEV MKFSPGSMRA  300
IHAARKYSPK HPSFMVVLYP YNCCNNVLYV PRGFSEKYLS EAPNYLILEV SDGREWQVRV  360
RKNCRRLDLG RGLTAFFRDN NLKAGDVCIF ELIKNTEVMK ASLFHAVQDD LEIITSETCE  420
STNVSAESKK AIDAARMYKP ANPSFMVVLR PYNCYDHGLS VPRIFSKWYL WRARKCIKVK  480
VSDGREWTIC LQKSCKHLVF QMGWKEFCKD NNLKAGDVCV FELITKNRVL KASIFHANQD  540
AGPEN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1729953919144B3 domain-containing transcription factor VRN1
4i1k_B2e-1729953919144B3 domain-containing transcription factor VRN1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap29851.m002491
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519138.10.0B3 domain-containing transcription factor VRN1 isoform X1
RefseqXP_015574586.10.0B3 domain-containing transcription factor VRN1 isoform X1
RefseqXP_015574587.10.0B3 domain-containing transcription factor VRN1 isoform X1
RefseqXP_015574588.10.0B3 domain-containing transcription factor VRN1 isoform X1
TrEMBLB9RZG90.0B9RZG9_RICCO; Uncharacterized protein
STRINGXP_002519138.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1642569
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.18e-42B3 family protein