PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29848.m004660
Common NameRCOM_0924640
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family CPP
Protein Properties Length: 873aa    MW: 95499.1 Da    PI: 6.1932
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29848.m004660genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR48.71.5e-15452490341
            TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                    +k+CnCkk+kClk+YC+Cfaag +C++ C C+dC+N+ e
  29848.m004660 452 CKRCNCKKTKCLKLYCDCFAAGIYCADPCACQDCFNRPE 490
                    79**********************************876 PP

2TCR50.93e-16537575139
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                    ++k+gCnCkks ClkkYCeC++a++ Cs+eC+Ce+CkN 
  29848.m004660 537 RHKRGCNCKKSMCLKKYCECYQANVGCSSECRCEGCKNG 575
                    589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.4E-16450491IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.504451577IPR005172CRC domain
PfamPF036382.2E-11453488IPR005172CRC domain
SMARTSM011147.4E-17537578IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-11539574IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MGSHTPAKTS TSPSTSISAA STVVLSDSSS VQESPFLNYI NNLSPIKPVK VAHGAQGFGA  60
LSSPPLIFTS PRTLPERGTS FLQRSQLCQI SSAEMPENDD RRKKLVDHSN DFEDSVAHHS  120
RLITDTQKET FVKNSTLDQP GSSSGCIDEY LNDPVDVDGA NCVNLTNSKA FCEQGDKSSQ  180
VQPSIEINLR QAEEEKCGSK QPFNECQNIE SDLPVDHALE NKQCDGLGTH IIQANEDTDE  240
NAAATTHRAN QNIGQRDPEA GQLQRGMSRR CLQFEEARQK ITLNRIHSTD PTNNVNGSGS  300
PASTTELENL DSSYIEIAAY SHKKMINLSE PTTSMFPRFS GKSLVVVSKP SGIGLHLNSI  360
VTAMPMGHSG AESNKSTPIM SCHQDAGDRL LEAQDSEAAG AASSESFHTA ESLNILQPLV  420
HHVTPLKRRN FKLEHADNFE EKKSLSIDGD GCKRCNCKKT KCLKLYCDCF AAGIYCADPC  480
ACQDCFNRPE YEDTVLETRQ QIESRNPLAF APKIVQHAKE FAASREDRSS SMPSLSRHKR  540
GCNCKKSMCL KKYCECYQAN VGCSSECRCE GCKNGYGRKE EYGIIEETVS DRVGEERLEG  600
RVDDKLAIVA TDEDLLPAEL YDLHNLTPST PSFQHSDHGK STPKSPLSSS RHVPSPESDI  660
SILPSNAKST RSSRYCDTIP EASKETVDID SCDQGIDYNV SEMMSQFSSK CSALADIYDP  720
NPLTNPMTVT LGSSASSKTR DWSSGSRFQL CPGSGRLPSG RSVRWWNSPI TPMTRLGENK  780
IQGHDSDSGL YNILEDDTPE ILKEGSTPSA SVKASSPNKK RVSPPQNHIH DFRSSSSGGL  840
KSGRKFILRS VPSFPPLTPC VNSEGIREEK QQL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0101655e-38AJ010165.1 Glycine max mRNA for cysteine-rich polycomb-like protein (gpp1 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572571.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X1
RefseqXP_015572572.10.0PREDICTED: CRC domain-containing protein TSO1 isoform X1
TrEMBLB9RP780.0B9RP78_RICCO; Tso1, putative
STRINGPOPTR_0006s26740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.14e-60TESMIN/TSO1-like CXC 2