PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29848.m004480
Common NameRCOM_0919630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family B3
Protein Properties Length: 368aa    MW: 42278.6 Da    PI: 10.158
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29848.m004480genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B349.29.5e-1620931699
                   EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
             B3 16 lvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                    ++p +f+++ +g+ +e    +l+++ g+ W vk+  ++++    +++GWk+F+k ++L  gDf+vF+++g++ f  +v+vf+ 
  29848.m004480 20 PSIPVSFFKHLKGNRRE--IAVLRSTAGKLWHVKI--NGRR----FEDGWKDFAKYHDLHIGDFLVFRHEGDMVF--YVMVFDP 93
                   58******777888444..7999************..8887....9*************************9999..9999986 PP

2B359.65.6e-191732511193
                    HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
             B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                    +k++   +pkkfae++g+ + +  +++l d+++rsW   l y+k +g+++ ++GW+ F+ an+Lk gD+++F+l+++++ +l+
  29848.m004480 173 FKQN---IPKKFAEANGLYN-RYCKIVLVDQESRSWLADLGYKKADGTVYVKDGWSTFCIANDLKKGDSFIFELIKEKKPTLR 251
                    4444...*********8875.4569*************************************************986555444 PP

3B366.15.2e-21275367397
                    EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
             B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                    +v++++ ++k+++l +p++fa++++++  e  +++l++e+g sW+v l  + +s+ +++++GW+ F+ ang++egD +++k+++  ++++v++++
  29848.m004480 275 SVTVKAPYTKNSQLKIPRDFARRNNLNR-EYAKMILTNEKGSSWTVSLEKNSSSNDIYIGRGWSAFAAANGIREGDELMLKVIK-GGEKPVMRIC 367
                    667888999999************9996.5679***************87888888*************************998.7777899988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.49E-21296IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.8E-22296IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.252594IPR003340B3 DNA binding domain
CDDcd100171.69E-16692No hitNo description
SMARTSM010192.6E-17894IPR003340B3 DNA binding domain
PfamPF023621.3E-112192IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.3E-20147251IPR015300DNA-binding pseudobarrel domain
CDDcd100171.70E-15149246No hitNo description
SMARTSM010193.4E-15160258IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-17173251IPR015300DNA-binding pseudobarrel domain
PfamPF023627.9E-17173251IPR003340B3 DNA binding domain
PROSITE profilePS5086312.887177258IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.5E-19270367IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.692273368IPR003340B3 DNA binding domain
SuperFamilySSF1019361.53E-17274366IPR015300DNA-binding pseudobarrel domain
CDDcd100171.59E-16274367No hitNo description
SMARTSM010194.0E-16274368IPR003340B3 DNA binding domain
PfamPF023627.0E-19274367IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MSSSKPHFFQ PVLPGFEDEP SIPVSFFKHL KGNRREIAVL RSTAGKLWHV KINGRRFEDG  60
WKDFAKYHDL HIGDFLVFRH EGDMVFYVMV FDPSACEREY TSFNVKEEME TSEEEKEPAK  120
TSDLRKFTKN KQIMISVEGK GNPPVFENPH FAVNMTSYTA SHPRKPLKFI YLFKQNIPKK  180
FAEANGLYNR YCKIVLVDQE SRSWLADLGY KKADGTVYVK DGWSTFCIAN DLKKGDSFIF  240
ELIKEKKPTL RMSRLKRSLK TRKVGSSLTK DAQFSVTVKA PYTKNSQLKI PRDFARRNNL  300
NREYAKMILT NEKGSSWTVS LEKNSSSNDI YIGRGWSAFA AANGIREGDE LMLKVIKGGE  360
KPVMRICG
Cis-element ? help Back to Top
SourceLink
PlantRegMap29848.m004480
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572475.10.0B3 domain-containing protein REM7
TrEMBLB9RNQ00.0B9RNQ0_RICCO; DNA binding protein, putative
STRINGXP_002515369.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16161410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.16e-63B3 family protein