PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29848.m004479
Common NameRCOM_0919620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family B3
Protein Properties Length: 559aa    MW: 64386.1 Da    PI: 9.7761
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29848.m004479genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.31.6e-14994199
                   EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
             B3  1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                   ffk l     +++  + +p +f+ ++ +g+  e k  +l +  g+ W +k+  ++++    +++GWkeF + ++L +gDf+vF+++g++ f  +vkvf
  29848.m004479  9 FFKPL--LPGFEHE-FLIPVSFF-KYlKGQ--ECKNAVLSSCPGKLWPIKI--NGRR----FEDGWKEFTRHHDLHVGDFLVFRHEGDMLF--HVKVF 92
                   56666..5566665.99******.554777..4579***************..8887....9***********************999999..****9 PP

                   -S CS
             B3 98 rk 99
                   ++
  29848.m004479 93 DS 94
                   97 PP

2B339.41e-121592321994
                    -HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
             B3  19 pkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                    + +fa+ hg+++++  +++++de+grsW   l y+k++g+++++ GW +    n+Lk+gD + F+l+++ ++++++
  29848.m004479 159 STDFARLHGLINRRC-KMIVMDEEGRSWPTMLWYKKSDGQVFIGCGWTSCRIVNDLKQGDRLRFELIKN-GKRPLL 232
                    467888889997665.9999************9999*9****************************995.444555 PP

3B3604.1e-193364181498
                    T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
             B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                      l++p kfa+ h +++++  +++l d++grsW  kl  rk++g+ +++ GW+ F  an+Lk+gD+++F+l+g +++++v+k++r
  29848.m004479 336 FFLYIPMKFARLHCLDNRCC-KMILIDQEGRSWPAKLWCRKTDGQAYISYGWRAFSVANDLKQGDSFIFELIG-NGKRPVLKIHR 418
                    569**********7776665.9***************66999999***************************9.66669999987 PP

4B349.95.7e-16451537797
                    .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
             B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                    ++++ k ++l++p +fa++h++  e+s   tl+de+grsW v l  + k + ++++  W+ F+ +n ++egD+ +++l++  ++++v++++
  29848.m004479 451 RASYIKFSQLRIPINFARRHNLARECS-NATLMDERGRSWLVSL--KVKYKDIYIGYKWSAFAAENCVREGDVYMLELIK-GGEKPVLRIY 537
                    556666678***********9998887.****************..999999**************************98.6777888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.71E-194102IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.8E-20597IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.097695IPR003340B3 DNA binding domain
CDDcd100176.12E-17793No hitNo description
SMARTSM010192.1E-11995IPR003340B3 DNA binding domain
PfamPF023621.6E-101894IPR003340B3 DNA binding domain
CDDcd100171.86E-13148236No hitNo description
SMARTSM010191.8E-6153238IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.2E-11155236IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.06E-13156236IPR015300DNA-binding pseudobarrel domain
PfamPF023622.7E-11160232IPR003340B3 DNA binding domain
PROSITE profilePS508639.855174237IPR003340B3 DNA binding domain
SuperFamilySSF1019365.89E-21329415IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.1E-19329416IPR015300DNA-binding pseudobarrel domain
SMARTSM010194.1E-15332420IPR003340B3 DNA binding domain
CDDcd100174.60E-21336418No hitNo description
PfamPF023624.4E-17337418IPR003340B3 DNA binding domain
PROSITE profilePS5086312.534338419IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.4E-18438536IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.96E-15443537IPR015300DNA-binding pseudobarrel domain
SMARTSM010195.1E-14445540IPR003340B3 DNA binding domain
PROSITE profilePS5086312.393445540IPR003340B3 DNA binding domain
PfamPF023622.4E-14449537IPR003340B3 DNA binding domain
CDDcd100172.73E-14449537No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MLLPSKPHFF KPLLPGFEHE FLIPVSFFKY LKGQECKNAV LSSCPGKLWP IKINGRRFED  60
GWKEFTRHHD LHVGDFLVFR HEGDMLFHVK VFDSSTCARD YPFFSIKEEK IEIHEEEPAQ  120
KSSPNWSVIS TYALNMYGFI FICTHWLDSL ICIFKQHMST DFARLHGLIN RRCKMIVMDE  180
EGRSWPTMLW YKKSDGQVFI GCGWTSCRIV NDLKQGDRLR FELIKNGKRP LLKMNKNLSF  240
FDQSCCEGLQ ANTEAKRDRN YDGEQAGSSS TRRHSVNATS KASYSRDSQL ANQVQLQKIP  300
KNEVATESGS SKPQKKKRPT TSSKAKACPS GLQHPFFLYI PMKFARLHCL DNRCCKMILI  360
DQEGRSWPAK LWCRKTDGQA YISYGWRAFS VANDLKQGDS FIFELIGNGK RPVLKIHRLE  420
TNPKTEEEQT YNVAQAGSSS TRLPQVAITV RASYIKFSQL RIPINFARRH NLARECSNAT  480
LMDERGRSWL VSLKVKYKDI YIGYKWSAFA AENCVREGDV YMLELIKGGE KPVLRIYANA  540
ASAFRSFFPL VHGTTYKID
Cis-element ? help Back to Top
SourceLink
PlantRegMap29848.m004479
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572610.10.0B3 domain-containing protein REM8 isoform X2
TrEMBLB9RNP90.0B9RNP9_RICCO; Uncharacterized protein
STRINGXP_002515368.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16161410
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00260.16e-62B3 family protein