PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29842.m003687
Common NameLOC8267416, RCOM_0906550
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GeBP
Protein Properties Length: 391aa    MW: 43637.7 Da    PI: 5.0581
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29842.m003687genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573113.11.8e-35167262298
         DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                    lfqrlwse+Deiv+L+G+idf +k+g++p +di  f++++kks++f+vs +ql +Ki rLKkKf+++vk  k+g++++fsk+hdqk+f+lskkiWg
  29842.m003687 167 LFQRLWSEDDEIVVLKGIIDFIEKKGVDPAKDIISFFDYIKKSLHFDVSLNQLKDKIWRLKKKFENNVKG-KKGEDKTFSKSHDQKSFDLSKKIWG 261
                    79******************************************************************99.9***********************9 PP

         DUF573  98 s 98 
                    +
  29842.m003687 262 T 262
                    5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.6E-31168261IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MAPKRSTPLE DPPAASSSEE EEEGTSSGEE EEEEEEEEGS SSEEEQETQK PQTQIVTPKP  60
PPKQPESESE SESGSGSETD DDEKPKKAPN STVKPIASKP MEETPPKTTK PRSKPAPKPT  120
TAAAAGKRAS EVDREPKDSK RAKKKDPESD GAVTATAEKS EDTKKQLFQR LWSEDDEIVV  180
LKGIIDFIEK KGVDPAKDII SFFDYIKKSL HFDVSLNQLK DKIWRLKKKF ENNVKGKKGE  240
DKTFSKSHDQ KSFDLSKKIW GTDGIIGASD SSIKPNGKAK KATNNNAKSL VALKAELGMD  300
VDKENEKVDK MDVELENHSS LKQFDRGVGV SGMEDYVIKR GLDMVQGAKK AEMEEKWRKL  360
HVAELELFLR RNELTREQAK LMLASYKNEQ D
Cis-element ? help Back to Top
SourceLink
PlantRegMap29842.m003687
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518574.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLB9RXV50.0B9RXV5_RICCO; Transcription regulator, putative
STRINGXP_002518574.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25210.12e-30DNA-binding storekeeper protein-related transcriptional regulator