PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29832.m000310
Common NameLOC8263897, RCOM_0876400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 195aa    MW: 22835.2 Da    PI: 5.8246
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29832.m000310genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.68.6e-1681130554
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                    +++rr+++NRe+ArrsR RK++ ++eL   v  L +eN++L+++l++ ++
  29832.m000310  81 RKQRRMISNRESARRSRMRKQKHLDELWSQVIWLRNENHQLIDKLNHVSE 130
                    689******************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.3E-1577141IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.42779142IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.8E-1381154No hitNo description
PfamPF001701.7E-1381130IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.79E-1381134No hitNo description
CDDcd147024.30E-1982133No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MQPSEVTGFH YLLPSNHSPY STYFNMSHNI TPTFQFNRFP DPHNFQIPPQ LQEFSLQTSS  60
LSNNSTSDEA DEQQLSLINE RKQRRMISNR ESARRSRMRK QKHLDELWSQ VIWLRNENHQ  120
LIDKLNHVSE CHDQVVQENA QLKEETSELR QMLSDLQLNS PYATLRDLQE IPCNTDYLRA  180
ESSNQSITSS TDLLG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193100RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap29832.m000310
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530800.11e-142basic leucine zipper 43
SwissprotQ9FMC21e-46BZP43_ARATH; Basic leucine zipper 43
TrEMBLB9SXT11e-141B9SXT1_RICCO; Ocs element-binding factor, putative
STRINGXP_002530800.11e-142(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16043399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.17e-51basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]