PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29827.m002603
Common NameLOC8280090, RCOM_0866520
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family Trihelix
Protein Properties Length: 286aa    MW: 33975.2 Da    PI: 5.8516
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29827.m002603genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix80.52.3e-2536117186
       trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                    +W ++e+++Li +r e+e+++  +k++k+lWe vs kmrerg++r+p qCk+kw+nl +ryk  ++++ ++      +cp+f++l+
  29827.m002603  36 QWGEEETKELIGIRGELEKDFTVAKRNKALWEIVSVKMRERGYHRTPPQCKCKWKNLINRYKGKETSDPDN----GLHCPFFEELH 117
                    7**************************************************************99999984....457******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.3292993IPR017877Myb-like domain
PfamPF138375.1E-2335118No hitNo description
CDDcd122034.57E-2336100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MFSSGDNNSL FRTIKVMAEV SGSVSPASSS SQVQVQWGEE ETKELIGIRG ELEKDFTVAK  60
RNKALWEIVS VKMRERGYHR TPPQCKCKWK NLINRYKGKE TSDPDNGLHC PFFEELHAVF  120
TERAKDMQRL LLESEAGSTQ GKKRFKRSFD EFSEDEDEDE DGSGEERPAK INLRKRKGER  180
IVPEMSSNAD IGGIQEMLKE FLQQQQQMEM QWREMMERRV HEQRRFEEEW RQAMEKIERE  240
RLMVEQAWRE REEQRRVREE NRAERRDALL TTLLDKLIHE NDMQGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A3e-1337107777DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002519887.10.0PREDICTED: trihelix transcription factor GT-3b
TrEMBLB9S1M20.0B9S1M2_RICCO; Transcription factor, putative
STRINGGLYMA01G35370.21e-107(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-29Trihelix family protein