PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29825.m000313
Common NameLOC8267677, RCOM_0858310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HD-ZIP
Protein Properties Length: 289aa    MW: 32327.7 Da    PI: 8.6295
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29825.m000313genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18143197256
                    T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  29825.m000313 143 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTK 197
                    788899***********************************************98 PP

2HD-ZIP_I/II125.23e-40143232191
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                    +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ +l
  29825.m000313 143 RKKLRLTKEQSALLEESFKQHSTLNPKQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK-AL 232
                    69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-19132200IPR009057Homeodomain-like
PROSITE profilePS5007117.75139199IPR001356Homeobox domain
SMARTSM003897.3E-16141203IPR001356Homeobox domain
PfamPF000464.2E-16143197IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.1E-17143197IPR009057Homeodomain-like
CDDcd000867.49E-17143200No hitNo description
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
PfamPF021835.6E-10199233IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.7E-26199242IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGCLDDGCNT GLVLGLGFTT ATISNPDSTI NNQNNQKLKT KPCLKFDQMV GTASFEPSLS  60
LGLSAHHIGS SNNKMKIDVI KKATCHEDSV DLFRQASPHS CSAVSSFSSG RVKRERDFSS  120
EEIDVERVSS RISDEDEDGT NTRKKLRLTK EQSALLEESF KQHSTLNPKQ KQALARQLNL  180
RPRQVEVWFQ NRRARTKLKQ TEVDCEFLKK CCETLTDENR RLQKELQELK ALKLAQPFYM  240
HMPAATLTMC PSCERIGGVG DAASKNNPFS MAPKPHHFYN PFTNPSAAC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141147TRKKLRL
2191199RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap29825.m000313
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002530591.10.0homeobox-leucine zipper protein HAT22
SwissprotP466045e-96HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLB9SX720.0B9SX72_RICCO; Homeobox protein, putative
STRINGXP_002530591.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.18e-87HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]