PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29822.m003500
Common NameRCOM_0855480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family HD-ZIP
Protein Properties Length: 300aa    MW: 34233.2 Da    PI: 6.8341
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29822.m003500genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.4e-1877129456
                    -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
       Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                    + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  29822.m003500  77 KKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 129
                    4568889*********************************************9 PP

2HD-ZIP_I/II129.61.2e-4175167193
    HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                    ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlEkdy++Lk+++dalk++ne L++++++L++el++
  29822.m003500  75 EKKKRLNLEQVKALEKSFELGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLEKDYDVLKKQFDALKADNEVLQTQNKKLHAELMD 167
                    69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-1967133IPR009057Homeodomain-like
PROSITE profilePS5007116.97371131IPR001356Homeobox domain
SMARTSM003891.5E-1774135IPR001356Homeobox domain
CDDcd000861.85E-1576132No hitNo description
PfamPF000463.0E-1577129IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-1979139IPR009057Homeodomain-like
PRINTSPR000311.1E-5102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5111127IPR000047Helix-turn-helix motif
PfamPF021833.4E-15131171IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MAFPPHGFLF HSQEDNDHLP SPSSLNSLPS CPPHLFPGGG HFLMKRSMSF SGVEKCEEGV  60
HGDDDLSDDG SQLGEKKKRL NLEQVKALEK SFELGNKLEP ERKMQLAKAL GLQPRQIAIW  120
FQNRRARWKT KQLEKDYDVL KKQFDALKAD NEVLQTQNKK LHAELMDLKG RDSNDVNLKK  180
ETDQGSWSNG SENSCDANNL DISRTPVATS PVSSQLTTKH LFSTSIRPTS MTQLLQTSSR  240
PSSDHPQCLK IDNHHHHHQL IQEENFCNMF NGMEEQQGFW PWPEQHQPFS LNQTHQFSNN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123131RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap29822.m003500
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002517497.20.0homeobox-leucine zipper protein ATHB-20
SwissprotQ8LAT05e-94ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLB9RUQ20.0B9RUQ2_RICCO; Homeobox protein, putative
STRINGXP_002517497.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01220.11e-78homeobox protein 20