PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29822.m003452
Common NameRCOM_0853770
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family LBD
Protein Properties Length: 161aa    MW: 18110.8 Da    PI: 8.6413
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29822.m003452genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260119.71.6e-37201201101
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    aCaaCk+ rrkCa+ C+lapyfpa+q+++f+n+++lFG+ +++k+l+++++++red+m s+ ye+++ra+ Pv+G+ gv+ +lq+q++q+ +el l
  29822.m003452  20 ACAACKYRRRKCAEACALAPYFPADQEETFRNAQRLFGVCRIQKMLRQADKDKREDVMVSIKYESNMRAEYPVHGCRGVVCHLQSQIQQVMQELTL 115
                    7*********************************************************************************************** PP

         DUF260  97 lkeel 101
                    ++++l
  29822.m003452 116 VNKQL 120
                    99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.00819120IPR004883Lateral organ boundaries, LOB
PfamPF031958.7E-3520117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MSIYLRVLMA GKGRSTSQQA CAACKYRRRK CAEACALAPY FPADQEETFR NAQRLFGVCR  60
IQKMLRQADK DKREDVMVSI KYESNMRAEY PVHGCRGVVC HLQSQIQQVM QELTLVNKQL  120
ALCKDHSDGL LTNGNGDNSV DNARLSNNDI VGSKCIYGEI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-242112012111LOB family transfactor Ramosa2.1
5ly0_B1e-242112012111LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMap29822.m003452
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002517449.31e-118LOB domain-containing protein 22
TrEMBLB9RUK41e-116B9RUK4_RICCO; LOB domain-containing protein, putative
STRINGXP_002517449.11e-117(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.11e-31LOB domain-containing protein 27