PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29813.m001508
Common NameRCOM_0837230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 360aa    MW: 40523.1 Da    PI: 7.8761
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29813.m001508genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.69.1e-201053245
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                   + en+  rq t+ kR++gi+KKA+ELS+LCd+++ +++fs+tgk
  29813.m001508 10 KLENTNGRQATYGKRKHGIIKKAKELSILCDIDIILLMFSPTGK 53
                   6799**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.352153IPR002100Transcription factor, MADS-box
SMARTSM004322.7E-26160IPR002100Transcription factor, MADS-box
CDDcd002666.96E-24281No hitNo description
SuperFamilySSF554553.53E-24294IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-15323IPR002100Transcription factor, MADS-box
PfamPF003193.8E-171154IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT YGKRKHGIIK KAKELSILCD IDIILLMFSP TGKPSICKGK  60
RSIEEVIAKF AQLTPQERAK RKLESLEALK KTFKKLDHDV NIPEFLGTSS QTIEELTNQL  120
RLLQSHLSEA HKRLSYWTCP DKINSIDHLG QLENSLRESL NQIQAHKEYI EKQQLMSLEC  180
NSQFQNGMHL PFRMGAEQQL PPMQWIPNND SQQIVLPEDP NLLPHRDVEC SASSSFGSYS  240
GYFGTGKSSE LSNSSQENGL NGILNELNGT ASLRLQLAGQ YPHLPYNLNM LNDTKFQPAA  300
DMNIQESPVD FHVNGSFEVP KPGYDTTPGS WASSSGPCAV TMFDEQLYSR IMLYYMAAKS
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms heterodimers with the MADS-box proteins AGL66 and AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29813.m001508
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015576858.10.0agamous-like MADS-box protein AGL30 isoform X3
SwissprotQ1PFA41e-116AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLB9S8Y70.0B9S8Y7_RICCO; Mads box protein, putative
STRINGXP_002522456.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27503370
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.29e-88AGAMOUS-like 30
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]