PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29807.m000474
Common NameLOC8276198, RCOM_0825660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family G2-like
Protein Properties Length: 474aa    MW: 52093.1 Da    PI: 7.3712
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29807.m000474genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.36.1e-32251306156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  29807.m000474 251 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 306
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.38E-17248309IPR009057Homeodomain-like
PROSITE profilePS5129413.355248308IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-28249309IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-26251306IPR006447Myb domain, plants
PfamPF002498.4E-7253304IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MASPSELTLD CKPHSYSMLL KSFGDQNDHT QKLEEFLSRL EEEKLKIDAF KRELPLCMQL  60
LTDAVETSRQ QLQAYRANQG PRRILEEFMP LKNSTSETLD KSSNMSDKAN WMTTAQLWSQ  120
ESNEIKPQTT FNSPKETNIG FNVSPKLGLD TKQRNGGAFL PFSKERNLCP SPTLALASTD  180
KELMEDKKCL ETENGLSCSK RDNSSKVSNG GIMIEHGKGN GNLASCDGQP TNTGTGNNST  240
NTSTTTQTHR KARRCWSPDL HRRFVNALQM LGGSQVATPK QIRELMKVDG LTNDEVKSHL  300
QKYRLHTRRP SPSPQAPGAP TPQLVVLGGI WVPPEYATAA HGGTPTLYGT HHHPVSHAPP  360
PHFCAAPPVP QDFYTAAAAA GATTPPLPPP HHQLHHHTLH HQLHMYNKAT SQAHSSPESD  420
IRGTGDRSES IEDGKSESSS WKAESGENGG ERKGLAAFRE DGEESNGSEI TLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-13251304154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13251304154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13251304154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13251304154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMap29807.m000474
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002529346.10.0myb family transcription factor EFM
SwissprotQ9ZQ851e-135EFM_ARATH; Myb family transcription factor EFM
TrEMBLB9STM70.0B9STM7_RICCO; Uncharacterized protein
STRINGXP_002529346.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF54663455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-130G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]