PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29804.m001495
Common NameLOC8279162, RCOM_0816450
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family bZIP
Protein Properties Length: 386aa    MW: 41770.2 Da    PI: 6.7616
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29804.m001495genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.77e-10188235552
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
         bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                    kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  29804.m001495 188 KRAKRILANRQSAARSKERKARYILELERKVQTLQTEATTLSAQLTLF 235
                    9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-15184248IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.392186249IPR004827Basic-leucine zipper domain
PfamPF001701.3E-8188234IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.88E-10188239No hitNo description
Gene3DG3DSA:1.20.5.1706.9E-10188242No hitNo description
CDDcd147031.01E-23189238No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MDIQDPNSKT ISNPKDPNHQ NAAPKNGLPN SSSTSIFTLR PGPHHRRAHS EMSFRLPEDV  60
TTMMMDLSPS DPINGGGPGG GGGGGVGGGG GGGGSSVGSF EEMGSEDDLF STYIDVDKLT  120
GGGNGTDQSN NNNNNNDEKN GEGEKGMPTR PKHRHSNSVD GSVCGEVMEA KKAMPPDKLA  180
ELWSLDPKRA KRILANRQSA ARSKERKARY ILELERKVQT LQTEATTLSA QLTLFQRDTT  240
GLSTENIELK LRLQAMEQQA QLRDALNEAL KKEVERLKIA TREIMSPSES FNLGMHQMPY  300
TPSNFFSHPQ QSGSANHPNM QFPPYAHSQT SIPGHHLHQT NSHTFSELMQ NDSLGRLQGL  360
DISSKGPNIV KSEGPSLSAS ESSSTF
Functional Description ? help Back to Top
Source Description
UniProtTranscrition factor that may participate with bZIP34 in the gametophytic control of pollen development. {ECO:0000269|PubMed:27896439}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29804.m001495
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002518293.10.0transcription factor RF2b
SwissprotO228731e-105BZP18_ARATH; bZIP transcription factor 18
TrEMBLB9RX240.0B9RX24_RICCO; Transcription factor RF2b, putative
STRINGXP_002518293.10.0(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15483497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.11e-100bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Pawar V, et al.
    A novel family of plant nuclear envelope-associated proteins.
    J. Exp. Bot., 2016. 67(19): p. 5699-5710
    [PMID:27630107]
  3. Gibalová A, et al.
    Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte.
    Plant Reprod, 2017. 30(1): p. 1-17
    [PMID:27896439]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  5. Babiychuk E,Fuangthong M,Van Montagu M,Inzé D,Kushnir S
    Efficient gene tagging in Arabidopsis thaliana using a gene trap approach.
    Proc. Natl. Acad. Sci. U.S.A., 1997. 94(23): p. 12722-7
    [PMID:9356517]