PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29739.m003627
Common NameRCOM_0707590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family M-type_MADS
Protein Properties Length: 62aa    MW: 6985.46 Da    PI: 11.0493
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29739.m003627genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF52.56.1e-171153345
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    e+   rqv +skR+ g+lKK +EL +LCd++  +i+fs++gk
  29739.m003627 11 LESVKARQVKYSKRKLGVLKKGKELATLCDVDLGLIMFSPSGK 53
                   578889***********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.9E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.025161IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-19260IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-15323IPR002100Transcription factor, MADS-box
PfamPF003192.1E-171155IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-152338IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-153859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 62 aa     Download sequence    Send to blast
MGRRKLKILR LESVKARQVK YSKRKLGVLK KGKELATLCD VDLGLIMFSP SGKPSLYVGH  60
DK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}.
Cis-element ? help Back to Top
SourceLink
PlantRegMap29739.m003627
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025012616.16e-37agamous-like MADS-box protein AGL65
SwissprotQ7X9I02e-18AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLB9RQX62e-35B9RQX6_RICCO; Mads box protein, putative
STRINGXP_002516145.14e-36(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2051955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.18e-21AGAMOUS-like 65
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]