PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29729.m002278
Common NameLOC8272084, RCOM_0687290
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family LBD
Protein Properties Length: 173aa    MW: 19274.9 Da    PI: 6.7041
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29729.m002278genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.47e-4561051100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+
  29729.m002278   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPIHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVSQLQMQLAV 101
                    7*********************************************************************************************** PP

         DUF260  97 lkee 100
                    +++e
  29729.m002278 102 AQAE 105
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0875106IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPIHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVSQLQMQLA VAQAEILCIQ MQNEPAVVMP  120
TPQIEHNDDD DAKSFLYQQN TLPHHHQYLN FASSSSVIHD SLKRESIFGD IIS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755181e-34HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002520780.11e-127PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW38e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLB9S4611e-127B9S461_RICCO; LOB domain-containing protein, putative
STRINGPOPTR_0010s19180.12e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-79LBD family protein